DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Galphaq and gnat1

DIOPT Version :9

Sequence 1:NP_725192.2 Gene:Galphaq / 36384 FlyBaseID:FBgn0004435 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_571943.1 Gene:gnat1 / 140428 ZFINID:ZDB-GENE-011128-11 Length:350 Species:Danio rerio


Alignment Length:392 Identity:175/392 - (44%)
Similarity:230/392 - (58%) Gaps:52/392 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 AKEQKRINQEIEKQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDEDKRGYIKLV 73
            |..:::.::|:||:|:.|.....|.:||||||.|||||||.:|||:|||..|||.|:...:|.::
Zfish     5 ASAEEKHSRELEKKLKEDADKDARTVKLLLLGAGESGKSTIVKQMKIIHKDGYSLEECLEFIVII 69

  Fly    74 FQNIFMAMQSMIKAMDMLKISYGQGEHSELADLVMSIDYETVT--TFEDPYLNAIKTLWDDAGIQ 136
            :.|...::.::::||..|.|.||.....:.|..:|.: .:|:.  |......:.|..||.|:|||
Zfish    70 YSNTMQSILAVVRAMTTLNIGYGDAAAQDDARKLMHL-ADTIEEGTMPKELSDIILRLWKDSGIQ 133

  Fly   137 ECYDRRREYQLTDSAKYYLKDLDRVAQPAYLPTEQDILRVRVPTTGIIEYPFDLEEIRFSYLSDL 201
            .|:||..||||.|||.|||.||:|:.||.|:|||||:||.||.||||||..|..:::.       
Zfish   134 ACFDRASEYQLNDSAGYYLNDLERLIQPGYVPTEQDVLRSRVKTTGIIETQFSFKDLN------- 191

  Fly   202 ARIEQADYLPTEQDILRARVPTTGILEYPFDLDGIVFRMVDVGGQRSERRKWIHCFENVTSIIFL 266
                                                |||.|||||||||:|||||||.||.|||:
Zfish   192 ------------------------------------FRMFDVGGQRSERKKWIHCFEGVTCIIFI 220

  Fly   267 VALSEYDQILFESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIMYSHLVDYFPE 331
            .|||.||.:|.|.|..|||.||..||.:|..:.:|..:|::|||||||:..|||..:||...|||
Zfish   221 AALSAYDMVLVEDDEVNRMHESLHLFNSICNHRYFATTSIVLFLNKKDVFVEKIKKAHLSMCFPE 285

  Fly   332 YDGPQ--RDAITAREFILRMFVDLNPDSE-KIIYSHFTCATDTENIKLVFCAVKDTIMQNALKEF 393
            ||||.  .|   |..:|...|:|||...: |.||||.||||||||:|.||.||.|.|::..||:.
Zfish   286 YDGPNTFED---AGNYIKVQFLDLNLRRDIKEIYSHMTCATDTENVKFVFDAVTDIIIKENLKDC 347

  Fly   394 NL 395
            .|
Zfish   348 GL 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalphaqNP_725192.2 G-alpha 34..390 CDD:206639 165/360 (46%)
gnat1NP_571943.1 G_alpha 9..348 CDD:214595 173/385 (45%)
G-alpha 30..344 CDD:206639 165/360 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0082
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54330
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000052
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X53
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.