DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Galphaq and gnat2

DIOPT Version :9

Sequence 1:NP_725192.2 Gene:Galphaq / 36384 FlyBaseID:FBgn0004435 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_001135577.1 Gene:gnat2 / 100216126 XenbaseID:XB-GENE-6258657 Length:354 Species:Xenopus tropicalis


Alignment Length:397 Identity:173/397 - (43%)
Similarity:230/397 - (57%) Gaps:56/397 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SEEAKEQKRINQEIEKQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDEDKRGYI 70
            |.|.||..:.::|:||:|:.|.....:.:||||||.|||||||.:|||:|||..|||:::...:.
 Frog     6 SAEDKELAKRSKELEKKLQEDAAMDAKTVKLLLLGAGESGKSTIVKQMKIIHQDGYSEQECIEFR 70

  Fly    71 KLVFQNIFMAMQSMIKAMDMLKISYGQGEHSE----LADLVMSIDYETVTTFEDPYLNAIKTLWD 131
            .:::.||..::.::|:||..|.|.||....::    |:.|..||:..|:   ....::.||.||.
 Frog    71 AIIYGNILQSILAIIRAMSTLGIDYGDSSRADDGRILSHLADSIEEGTM---PQELVDVIKKLWK 132

  Fly   132 DAGIQECYDRRREYQLTDSAKYYLKDLDRVAQPAYLPTEQDILRVRVPTTGIIEYPFDLEEIRFS 196
            |.|:|.|::|..||||.|||.|||..|||:....|:|.|||:||.||.||||||..|..:::.  
 Frog   133 DDGVQACFERAAEYQLNDSAAYYLNQLDRITASNYIPNEQDVLRSRVKTTGIIESQFSFKDLH-- 195

  Fly   197 YLSDLARIEQADYLPTEQDILRARVPTTGILEYPFDLDGIVFRMVDVGGQRSERRKWIHCFENVT 261
                                                     |||.|||||||||:|||||||.||
 Frog   196 -----------------------------------------FRMFDVGGQRSERKKWIHCFEGVT 219

  Fly   262 SIIFLVALSEYDQILFESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIMYSHLV 326
            .|||..|||.||.:|.|.:..|||.||..||.:|..:.:|..:|::||||||||.|:||...||.
 Frog   220 CIIFCGALSAYDMVLVEDEEVNRMHESLHLFNSICNHKFFAATSIVLFLNKKDLFEQKIKKVHLS 284

  Fly   327 DYFPEYDGPQR-DAITAREFILRMFVDLN--PDSEKIIYSHFTCATDTENIKLVFCAVKDTIMQN 388
            ..||:||||.. |  .|..:|.:.|:|||  .|| |.||.|.||||||:|:|.||.||.|.|::.
 Frog   285 ICFPDYDGPNTFD--DAGNYIKQQFLDLNMRKDS-KEIYGHMTCATDTQNVKFVFDAVTDIIIKE 346

  Fly   389 ALKEFNL 395
            .||:..|
 Frog   347 TLKDCGL 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalphaqNP_725192.2 G-alpha 34..390 CDD:206639 161/362 (44%)
gnat2NP_001135577.1 G-alpha 34..348 CDD:206639 161/362 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54330
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000052
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R507
SonicParanoid 1 1.000 - - X53
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.