DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Galphaq and gnat1

DIOPT Version :9

Sequence 1:NP_725192.2 Gene:Galphaq / 36384 FlyBaseID:FBgn0004435 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_001096278.1 Gene:gnat1 / 100124843 XenbaseID:XB-GENE-1003264 Length:350 Species:Xenopus tropicalis


Alignment Length:394 Identity:174/394 - (44%)
Similarity:230/394 - (58%) Gaps:56/394 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 AKEQKRINQEIEKQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDEDKRGYIKLV 73
            |..:::.::|:||:|:.|.....|.:||||||.|||||||.:|||:|||..|||.|:...:|.::
 Frog     5 ASAEEKHSRELEKKLKEDAEKDARTVKLLLLGAGESGKSTIVKQMKIIHQDGYSLEECLEFISII 69

  Fly    74 FQNIFMAMQSMIKAMDMLKISYG----QGEHSELADLVMSIDYETVTTFEDPYLNAIKTLWDDAG 134
            :.|...:|.::::||:.|.|.||    |.:..:|..|..:||..::   .....:.|..||.|.|
 Frog    70 YGNTLQSMLAIVRAMNTLNIQYGDPARQDDSRKLLHLADTIDEGSM---PKEMSDIIGRLWKDTG 131

  Fly   135 IQECYDRRREYQLTDSAKYYLKDLDRVAQPAYLPTEQDILRVRVPTTGIIEYPFDLEEIRFSYLS 199
            ||.|:||..||||.|||.|||.||:|:..|.|:|||||:||.||.||||||..|..:::.     
 Frog   132 IQACFDRASEYQLNDSAGYYLNDLERLVTPGYVPTEQDVLRSRVKTTGIIETQFGFKDLN----- 191

  Fly   200 DLARIEQADYLPTEQDILRARVPTTGILEYPFDLDGIVFRMVDVGGQRSERRKWIHCFENVTSII 264
                                                  |||.|||||||||:|||||||.||.||
 Frog   192 --------------------------------------FRMFDVGGQRSERKKWIHCFEGVTCII 218

  Fly   265 FLVALSEYDQILFESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIMYSHLVDYF 329
            |:.|||.||.:|.|.|..|||.||..||.:|..:.:|..:|::|||||||:..|||..:||...|
 Frog   219 FIAALSAYDMVLVEDDEVNRMHESLHLFNSICNHRYFATTSIVLFLNKKDVFTEKIKKAHLSICF 283

  Fly   330 PEYDGPQ--RDAITAREFILRMFVDLNPDSE-KIIYSHFTCATDTENIKLVFCAVKDTIMQNALK 391
            |:||||.  .|   |..:|...|::||...: |.||||.||||||||:|.||.||.|.|::..||
 Frog   284 PDYDGPNTYED---AGSYIKTQFLELNMRRDVKEIYSHMTCATDTENVKFVFDAVTDIIIKENLK 345

  Fly   392 EFNL 395
            :..|
 Frog   346 DCGL 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalphaqNP_725192.2 G-alpha 34..390 CDD:206639 164/362 (45%)
gnat1NP_001096278.1 G-alpha 30..344 CDD:206639 164/362 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54330
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000052
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X53
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.