DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Galphaq and gnai1

DIOPT Version :9

Sequence 1:NP_725192.2 Gene:Galphaq / 36384 FlyBaseID:FBgn0004435 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_001090865.1 Gene:gnai1 / 100038283 XenbaseID:XB-GENE-942094 Length:354 Species:Xenopus tropicalis


Alignment Length:401 Identity:179/401 - (44%)
Similarity:237/401 - (59%) Gaps:54/401 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MECCLSEEAKEQKRINQEIEKQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDED 65
            |.|.||.|.|.....::.|::.||.|...|.||:||||||.|||||||.:|||:|||.:|||:|:
 Frog     1 MGCTLSAEDKAAVERSKMIDRNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEAGYSEEE 65

  Fly    66 KRGYIKLVFQNIFMAMQSMIKAMDMLKISYGQGEHSELADLVMSIDYETVTTFEDPYLNA----- 125
            .:.|..:|:.|...::.::|:||..|||.:|....::.|..:    :......|:.::.|     
 Frog    66 CKQYKAVVYSNTIQSIIAIIRAMGRLKIDFGDPSRADDARQL----FVLAGAAEEGFMTAELAGV 126

  Fly   126 IKTLWDDAGIQECYDRRREYQLTDSAKYYLKDLDRVAQPAYLPTEQDILRVRVPTTGIIEYPFDL 190
            ||.||.|.|:|.|::|.|||||.|||.|||.||||:||.:|:||:||:||.||.||||:|..|..
 Frog   127 IKRLWKDGGVQACFNRSREYQLNDSAAYYLNDLDRIAQNSYIPTQQDVLRTRVKTTGIVETHFTF 191

  Fly   191 EEIRFSYLSDLARIEQADYLPTEQDILRARVPTTGILEYPFDLDGIVFRMVDVGGQRSERRKWIH 255
            :::.                                           |:|.|||||||||:||||
 Frog   192 KDLH-------------------------------------------FKMFDVGGQRSERKKWIH 213

  Fly   256 CFENVTSIIFLVALSEYDQILFESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKI 320
            |||.||:|||.||||:||.:|.|.:..|||.||..||.:|....||.::|:|||||||||.||||
 Frog   214 CFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKI 278

  Fly   321 MYSHLVDYFPEYDGPQRDAITAREFILRMFVDLNPDSE-KIIYSHFTCATDTENIKLVFCAVKDT 384
            ..|.|...:|||.| ......|..:|...|.|||...: |.||:||||||||:|::.||.||.|.
 Frog   279 KRSPLTICYPEYPG-SNTYEEAAAYIQCQFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDV 342

  Fly   385 IMQNALKEFNL 395
            |::|.||:..|
 Frog   343 IIKNNLKDCGL 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalphaqNP_725192.2 G-alpha 34..390 CDD:206639 163/361 (45%)
gnai1NP_001090865.1 G-alpha 34..348 CDD:206639 163/361 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000052
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X53
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.