DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Galphaq and si:ch211-207c7.2

DIOPT Version :9

Sequence 1:NP_725192.2 Gene:Galphaq / 36384 FlyBaseID:FBgn0004435 Length:396 Species:Drosophila melanogaster
Sequence 2:XP_003201106.1 Gene:si:ch211-207c7.2 / 100034591 ZFINID:ZDB-GENE-050208-540 Length:302 Species:Danio rerio


Alignment Length:397 Identity:123/397 - (30%)
Similarity:187/397 - (47%) Gaps:111/397 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 CCLSEEAKEQKRINQEIEKQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDEDKR 67
            ||||:..|.....|:||:......::..|||:|||:           |.|.:|     |:.:   
Zfish    12 CCLSKNKKNAIAKNKEIDLSFIEQRKRERREIKLLV-----------IDQWQI-----YAQQ--- 57

  Fly    68 GYIKLVFQNIFMAMQSMIKAMDMLKISYGQGEHSELADLVMSIDYETVTTFEDPYLNAIKTLWDD 132
                  |||                    |..| ::.:|:         :|.:|    |:.||.|
Zfish    58 ------FQN--------------------QDSH-QITELL---------SFVEP----IRHLWAD 82

  Fly   133 AGIQECY----DRRREYQLTDSAKYYLKDLDRVAQPAYLPTEQDILRVRVPTTGIIEYPFDLEEI 193
            .|.:.|:    |..|  .|| |.:|:   :||:.|                              
Zfish    83 EGFKNCFKLCKDNHR--HLT-SLEYF---VDRLEQ------------------------------ 111

  Fly   194 RFSYLSDLARIEQADYLPTEQDILRARVPTTGILEYPFDLDGIVFRMVDVGGQRSERRKWIHCFE 258
                      |...:|:|...||.|...||.||.|....::.:.||..:|.|||.:|:||||.||
Zfish   112 ----------ITANNYIPITADIFRTHSPTNGIAELTIPMNSVTFRFFNVSGQRGQRKKWIHHFE 166

  Fly   259 NVTSIIFLVALSEYDQILFESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIMYS 323
            |||::||:.:|||||:.| |.:|:||||||..||.::...|||..|.::|.|||||:|..||.:|
Zfish   167 NVTTVIFVASLSEYDEFL-EENNKNRMEESLPLFNSVTHSPWFAQSFILLLLNKKDILARKIQFS 230

  Fly   324 HLVDYFPEYDGPQRDAITAREFILRMFVDLNPDSEKIIYSHFTCATDTENIKLVFCAVKDTIMQN 388
            ||..:|||::|..::...|.:|:|:.: :.|...:..|||.|.|..|..:.:::|..|||:|::.
Zfish   231 HLKTFFPEFEGNIQNTDDAMKFMLKSY-ERNATPDPWIYSQFICVKDFTDTRIIFECVKDSIVRQ 294

  Fly   389 ALKEFNL 395
            .:.:|.|
Zfish   295 TIAQFEL 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalphaqNP_725192.2 G-alpha 34..390 CDD:206639 110/359 (31%)
si:ch211-207c7.2XP_003201106.1 G_alpha 22..296 CDD:214595 116/380 (31%)
G-alpha <71..295 CDD:206639 97/275 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.