DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Galphaq and gnai3

DIOPT Version :9

Sequence 1:NP_725192.2 Gene:Galphaq / 36384 FlyBaseID:FBgn0004435 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_001104720.1 Gene:gnai3 / 100006888 ZFINID:ZDB-GENE-070713-6 Length:354 Species:Danio rerio


Alignment Length:410 Identity:181/410 - (44%)
Similarity:233/410 - (56%) Gaps:72/410 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MECCLSEEAKEQKRINQEIEKQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDED 65
            |.|.||.|.|.....::.|::.||.|...|.||:||||||.|||||||.:|||:|||..|||:::
Zfish     1 MGCTLSTEDKAAMEKSKMIDRTLREDGEKASREVKLLLLGAGESGKSTIVKQMKIIHEDGYSEDE 65

  Fly    66 KRGYIKLVFQNIFMAMQSMIKAMDMLKISYGQGEHSELA-----------DLVMSIDYETVTTFE 119
            .:.|..:|:.|...::.::|:||..|||.:|....::.|           :.||:.|...|    
Zfish    66 CKQYKVVVYSNTIQSIIAIIRAMGRLKIDFGDPARADDARQLFVLAGTAEEGVMTADLSGV---- 126

  Fly   120 DPYLNAIKTLWDDAGIQECYDRRREYQLTDSAKYYLKDLDRVAQPAYLPTEQDILRVRVPTTGII 184
                  |:.||.|.|:|.|:.|.|||||.|||.|||.||:|::||.|.||:||:||.||.||||:
Zfish   127 ------IRRLWKDEGVQMCFVRSREYQLNDSAAYYLNDLERISQPTYTPTQQDVLRTRVKTTGIV 185

  Fly   185 EYPFDLEEIRFSYLSDLARIEQADYLPTEQDILRARVPTTGILEYPFDLDGIVFRMVDVGGQRSE 249
            |..|..:|                                           :.|:|.||||||||
Zfish   186 ETHFTFKE-------------------------------------------LYFKMFDVGGQRSE 207

  Fly   250 RRKWIHCFENVTSIIFLVALSEYDQILFESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKD 314
            |:|||||||.||:|||.||||:||.:|.|.:..|||.||..||.:|....||.::||||||||||
Zfish   208 RKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSVILFLNKKD 272

  Fly   315 LLEEKIMYSHLVDYFPEYDGPQRDAITARE---FILRMFVDLNPDSE-KIIYSHFTCATDTENIK 375
            |.|:||..|.|...:|||.|    ..|..|   :|...|.|||...| |.||:||||||||:|::
Zfish   273 LFEDKIKKSPLTICYPEYCG----TCTYEEAAAYIQCQFEDLNKRKETKEIYTHFTCATDTKNVQ 333

  Fly   376 LVFCAVKDTIMQNALKEFNL 395
            .||.||.|.|::|.|.|..|
Zfish   334 FVFDAVTDVIIKNNLIECGL 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalphaqNP_725192.2 G-alpha 34..390 CDD:206639 165/370 (45%)
gnai3NP_001104720.1 G_alpha 14..352 CDD:214595 174/394 (44%)
G-alpha 34..348 CDD:206639 165/370 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0082
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54330
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000052
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X53
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.