DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Amph and LSB1

DIOPT Version :9

Sequence 1:NP_523717.1 Gene:Amph / 36383 FlyBaseID:FBgn0027356 Length:602 Species:Drosophila melanogaster
Sequence 2:NP_011652.1 Gene:LSB1 / 853037 SGDID:S000003368 Length:241 Species:Saccharomyces cerevisiae


Alignment Length:119 Identity:31/119 - (26%)
Similarity:52/119 - (43%) Gaps:33/119 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   502 VVNRHSVNNLNKNPFEDDDE----RIYEV---------------PADANTADLPPGVLYRVKATY 547
            :|||...|..|:..|..:..    .|:|:               |.:|:|.:.       |:|.|
Yeast     5 LVNRSLKNIRNELEFLKESNVISGDIFELINSKLPEKWDGNQRSPQNADTEEY-------VEALY 62

  Fly   548 GYAKEDVDELSFEIGDLIRVIEYDDPEDQEEGWLMGQKEGTNEKGLFPANFTRP 601
            .:..:...:||.:.||.|:|:|...|:     |..|  :..|:.|:||||:.:|
Yeast    63 DFEAQQDGDLSLKTGDKIQVLEKISPD-----WYRG--KSNNKIGIFPANYVKP 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AmphNP_523717.1 BAR_Amphiphysin 26..238 CDD:153272
SH3_Amphiphysin 539..602 CDD:212724 20/63 (32%)
LSB1NP_011652.1 SH3 55..108 CDD:214620 19/66 (29%)
PRK14971 <100..>156 CDD:237874 6/10 (60%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157343051
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.