DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Amph and Bin3

DIOPT Version :9

Sequence 1:NP_523717.1 Gene:Amph / 36383 FlyBaseID:FBgn0027356 Length:602 Species:Drosophila melanogaster
Sequence 2:NP_001013204.1 Gene:Bin3 / 361065 RGDID:1308253 Length:253 Species:Rattus norvegicus


Alignment Length:256 Identity:59/256 - (23%)
Similarity:109/256 - (42%) Gaps:37/256 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 GRAKEKILQNLGKVDRTADEIFDDHLNNFNRQQASANRLQKEFNNYIRCVRAAQAASKT------ 76
            |:.|::|      |.:|.:..|:.......:.:....||||:..   :...|..|.||:      
  Rat     9 GQPKKQI------VSKTVERDFEREYGKLQQLEEQTKRLQKDMK---KSTDADLAMSKSAVKISL 64

  Fly    77 --LMDSVCEIYEPQWSGYDALQAQTGASESLWADFAHKLGDQVLIPLNTYTGQFPEMKKKVEKRN 139
              |.:.:||..:.......||.......::...:..:::...|:.||..:...||.:...|::|.
  Rat    65 DLLSNPLCEQDQDFLRMVTALDTAMKRMDAFNQEKVNQIQKTVIEPLKKFGSIFPSLNMAVKRRE 129

  Fly   140 RKLIDYDGQRHSFQNLQANANKRKDD-------VKLTKGREQLEEARRTYEILNTELHDELPALY 197
            :.|.||.       .|||...|.::.       .||.:.||:|...|..:|..|.:|.||:|..|
  Rat   130 QALQDYG-------RLQAKVEKYEEKEKTGPVLAKLHQAREELRPVREDFEAKNKQLLDEMPRFY 187

  Fly   198 DSRILFLVTNLQTLFATEQVFHNETAKIYSELEAIVDKLATESQRGSNTLRKQTSNPIKTS 258
            :||:.:...:.::|...:.::::|..||:.:|...:|      |.|.:...::..|..|.|
  Rat   188 NSRLDYFQPSFESLIRAQVIYYSEMHKIFGDLTQQLD------QPGHSDEHRERENETKLS 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AmphNP_523717.1 BAR_Amphiphysin 26..238 CDD:153272 51/226 (23%)
SH3_Amphiphysin 539..602 CDD:212724
Bin3NP_001013204.1 BAR_Bin3 12..236 CDD:153274 55/245 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3771
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.