DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Amph and bin3

DIOPT Version :9

Sequence 1:NP_523717.1 Gene:Amph / 36383 FlyBaseID:FBgn0027356 Length:602 Species:Drosophila melanogaster
Sequence 2:NP_001116516.1 Gene:bin3 / 323976 ZFINID:ZDB-GENE-030131-2696 Length:253 Species:Danio rerio


Alignment Length:272 Identity:64/272 - (23%)
Similarity:119/272 - (43%) Gaps:47/272 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 GRAKEKILQNLGKVDRTADEIFDDHLNNFNRQQASANRLQKEFNNYIRCVRAAQAASKT------ 76
            |:.:::|      |.:|.:..|:.......:.:....:|.|:..   :...|..|.||.      
Zfish     9 GQPRKQI------VSKTVERDFEREYEKLQKLEEQTKKLHKDMK---KSTEADLAMSKAAVKISG 64

  Fly    77 --LMDSVCEIYEPQWSGYDALQAQTGASESLWADFAHKLGDQVLIPLNTYTGQFPEMKKKVEKRN 139
              |.:.:||..:......:||.......::...:..:::...|:.||..|...||.:...|::|.
Zfish    65 DLLSNPLCEQDQHFLDSMNALDTAMKRMDAFNQEKVNQIQKTVIDPLKKYGSVFPSLNMAVKRRE 129

  Fly   140 RKLIDYDGQRHSFQNLQANANKRKDD-------VKLTKGREQLEEARRTYEILNTELHDELPALY 197
            :.|.||       :.||:...|.::.       |||.:.||:|:..|..:|..|.:|.||:|..|
Zfish   130 QALQDY-------KRLQSKVEKYEEKEKTGPIMVKLHQAREELKPVREDFEAKNKQLLDEMPKFY 187

  Fly   198 DSRILFLVTNLQTLFATEQVFHNETAKIYSELEAIVDKLA-TESQRGSNTLRKQTSNPIKTSSPV 261
            :|||.:...:.:.|...:.|:..|..||::||...:|:.| |:.|      |||.:         
Zfish   188 NSRIDYFQPSFEALIRAQVVYFTEMHKIFTELNDQIDQSALTDEQ------RKQEN--------- 237

  Fly   262 QSPVNKLNNANI 273
            ::.:|:|.:.:|
Zfish   238 EAKLNELRSLSI 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AmphNP_523717.1 BAR_Amphiphysin 26..238 CDD:153272 54/227 (24%)
SH3_Amphiphysin 539..602 CDD:212724
bin3NP_001116516.1 BAR_Bin3 12..236 CDD:153274 59/245 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.