DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Amph and hob3

DIOPT Version :9

Sequence 1:NP_523717.1 Gene:Amph / 36383 FlyBaseID:FBgn0027356 Length:602 Species:Drosophila melanogaster
Sequence 2:NP_595489.1 Gene:hob3 / 2541160 PomBaseID:SPBC725.09c Length:264 Species:Schizosaccharomyces pombe


Alignment Length:272 Identity:74/272 - (27%)
Similarity:123/272 - (45%) Gaps:24/272 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 QKHAGRAKEKILQNLGKVDRTADEIFDDHLNNFNRQQASANRLQKEFNNYIRCVRAAQAASKTLM 78
            :|...||...::...|.|:||.|..|:.....:...:::|.:||||...|:..:||..|:...:.
pombe     7 KKAVNRAGTSVMMKTGHVERTVDREFETEERRYRTMESAAKKLQKEAKGYLDALRAMTASQTRIA 71

  Fly    79 DSVCEIYEPQWS--GYDALQAQTGASESLWADFAHKLG----DQVLIPLNTYTGQFPEMKKKVEK 137
            :::...|....|  |..|...|  ..|.|.||...:|.    ..||.|::.:...||::...:.|
pombe    72 NTIDAFYGDAGSKDGVSAYYRQ--VVEDLDADTVKELDGPFRTTVLDPISRFCSYFPDINAAITK 134

  Fly   138 RNRKLIDYDGQRHSFQNLQANANKRKDDVKLTKGREQLEEARRTYEILNTELHDELPALYDSRIL 202
            ||.||:|:|..|...|.|....:  .|..||.:..::...|:..||.||.:|..|||.|...|:.
pombe   135 RNHKLLDHDAMRAKVQKLVDKPS--NDTTKLPRTEKEAAMAKEVYETLNNQLVSELPQLIALRVP 197

  Fly   203 FLVTNLQTLFATEQVFHNETAKIYSELEAIVDKLATESQRGSNTLRKQTSNPI---KTSSPVQSP 264
            :|..:.:.|...:..|..|.          .:|:|...|...|::|:..||.:   |....:|| 
pombe   198 YLDPSFEALVKIQLRFCREG----------YEKMAQVQQYFDNSVREDYSNGLLDDKVEQVLQS- 251

  Fly   265 VNKLNNANINSN 276
            :..|:.|.:|::
pombe   252 MRDLSIAGLNNS 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AmphNP_523717.1 BAR_Amphiphysin 26..238 CDD:153272 59/217 (27%)
SH3_Amphiphysin 539..602 CDD:212724
hob3NP_595489.1 BAR_Rvs161p 20..241 CDD:153275 65/234 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 88 1.000 Domainoid score I2125
eggNOG 1 0.900 - - E1_KOG3771
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm46972
orthoMCL 1 0.900 - - OOG6_105748
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R565
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.740

Return to query results.
Submit another query.