DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sin3A and AT1G27280

DIOPT Version :9

Sequence 1:NP_001246282.1 Gene:Sin3A / 36382 FlyBaseID:FBgn0022764 Length:2066 Species:Drosophila melanogaster
Sequence 2:NP_174047.1 Gene:AT1G27280 / 839616 AraportID:AT1G27280 Length:225 Species:Arabidopsis thaliana


Alignment Length:80 Identity:27/80 - (33%)
Similarity:42/80 - (52%) Gaps:0/80 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   265 NATPRLKVEDALSYLDQVKYQYADQPQIYNNFLDIMKEFKSHCIDTPGVIERVSTLFKGHTELIY 329
            :.:|...::||:||::.||..:.|:|..|..|..:..:.:...||..|.|.||..|.|.|..|:.
plant    72 SVSPDSTIDDAVSYINTVKEAFHDEPAKYYEFFQLFYDIRYRLIDVAGGITRVEELLKAHKNLLV 136

  Fly   330 GFNMFLPPGYKIEIH 344
            ..|.||||..:..:|
plant   137 RLNAFLPPEAQRILH 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sin3ANP_001246282.1 Sin3 238..1719 CDD:227889 27/80 (34%)
PAH 291..335 CDD:280780 13/43 (30%)
PAH 588..645 CDD:280780
PAH 936..980 CDD:280780
Sin3_corepress 1034..1133 CDD:285494
Sin3a_C 1502..>1710 CDD:293484
AT1G27280NP_174047.1 PAH 10..54 CDD:280780
PAH 98..142 CDD:280780 13/43 (30%)
PAH 185..>211 CDD:280780
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5602
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D253485at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12346
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.