DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sin3A and AT1G27270

DIOPT Version :9

Sequence 1:NP_001246282.1 Gene:Sin3A / 36382 FlyBaseID:FBgn0022764 Length:2066 Species:Drosophila melanogaster
Sequence 2:NP_174046.1 Gene:AT1G27270 / 839615 AraportID:AT1G27270 Length:241 Species:Arabidopsis thaliana


Alignment Length:103 Identity:31/103 - (30%)
Similarity:47/103 - (45%) Gaps:12/103 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   235 PLGKAQTPPSSVVANSIPVGGTTPPQGQSGNATPRLKVEDALSYLDQVKYQYADQPQIYNNFLDI 299
            |...|:...:.||..|:|.....|            .::||.|||:.||..:.|:|..|.....:
plant    86 PEASAEFHINKVVGRSVPPAVAVP------------TMDDATSYLNAVKEAFHDEPAKYMEITKL 138

  Fly   300 MKEFKSHCIDTPGVIERVSTLFKGHTELIYGFNMFLPP 337
            :.:.|:..|:...||.|:..|.|.|..|:.||.:||.|
plant   139 LTDLKARRINAASVIARMEELLKDHLNLLLGFCVFLSP 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sin3ANP_001246282.1 Sin3 238..1719 CDD:227889 30/100 (30%)
PAH 291..335 CDD:280780 12/43 (28%)
PAH 588..645 CDD:280780
PAH 936..980 CDD:280780
Sin3_corepress 1034..1133 CDD:285494
Sin3a_C 1502..>1710 CDD:293484
AT1G27270NP_174046.1 PAH 32..76 CDD:396992
Sin3 92..>180 CDD:227889 29/97 (30%)
PAH 194..238 CDD:396992
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5602
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D253485at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12346
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.