DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sin3A and AT1G27240

DIOPT Version :9

Sequence 1:NP_001246282.1 Gene:Sin3A / 36382 FlyBaseID:FBgn0022764 Length:2066 Species:Drosophila melanogaster
Sequence 2:NP_174043.1 Gene:AT1G27240 / 839612 AraportID:AT1G27240 Length:186 Species:Arabidopsis thaliana


Alignment Length:154 Identity:39/154 - (25%)
Similarity:64/154 - (41%) Gaps:48/154 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   269 RLKVE----DALSYLDQVKYQYADQPQIYNNFLDIMKEFKSHCIDTPGVIERVSTLFKGHTELIY 329
            |::||    ||.||:..||..:.|:|..|..|:.:|.:.:.|.:|....|.:::.|.|||..|:.
plant     5 RVQVEPTLSDAHSYITAVKEAFHDEPTKYEEFIKLMNDIRDHGVDKASGIAKLTELIKGHPRLLR 69

  Fly   330 GFNMFLPPGYKIEIHSDALGCSVPVVSMPSPPGAPTSTGTVHMLTGNSSMSGAGHIAIKT---TN 391
            |.:.|.|     :::.|                       :|            |.|.:|   .:
plant    70 GLSFFFP-----QVNRD-----------------------IH------------HEAKRTIILKD 94

  Fly   392 AATLTP-AAGAGAAAAAAAVAQIQ 414
            .||:.| ||..||.:....:.||:
plant    95 KATIPPEAAYRGAKSTYTKIKQIE 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sin3ANP_001246282.1 Sin3 238..1719 CDD:227889 39/154 (25%)
PAH 291..335 CDD:280780 12/43 (28%)
PAH 588..645 CDD:280780
PAH 936..980 CDD:280780
Sin3_corepress 1034..1133 CDD:285494
Sin3a_C 1502..>1710 CDD:293484
AT1G27240NP_174043.1 PAH 32..75 CDD:280780 12/42 (29%)
PAH 138..182 CDD:280780
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5602
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.