DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sin3A and AT1G24230

DIOPT Version :9

Sequence 1:NP_001246282.1 Gene:Sin3A / 36382 FlyBaseID:FBgn0022764 Length:2066 Species:Drosophila melanogaster
Sequence 2:NP_173833.1 Gene:AT1G24230 / 839037 AraportID:AT1G24230 Length:245 Species:Arabidopsis thaliana


Alignment Length:413 Identity:80/413 - (19%)
Similarity:128/413 - (30%) Gaps:189/413 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly   264 GNATPRLKVEDALSYLDQVKYQY-ADQPQIYNNFLDIMKEFKSHCIDTPGVIERVSTLFKGHTEL 327
            |:.:|...:::|.||::.||..: ||||..|..|||||.:.:::.:|...|:.|:..|.|.|..|
plant     4 GSLSPAFTIDEATSYINAVKEAFGADQPAKYREFLDIMLDLRANRVDLATVVPRMRELLKDHVNL 68

  Fly   328 IYGFNMFLPPGYKIEIHSDALGCSVPVVSMPSPPGAPTSTGTVHMLTGNSSMSGAGHIAIKTTNA 392
            :..||.|||...|...|.                                               
plant    69 LLRFNAFLPAEAKETFHD----------------------------------------------- 86

  Fly   393 ATLTPAAGAGAAAAAAAVAQIQSAGAVNLMTHGGASLTQTTIHALQQATPPQSQSPGGGHVHVSV 457
                                                 .::.|::|::                  
plant    87 -------------------------------------VRSYIYSLKE------------------ 96

  Fly   458 TNSTAANAVVPGQPGISVSAHNVPQNYSRDRERATITPTGQVAGAAANVNASASIVVGGPPTPNS 522
                              |..:.|..|::..|               .:|..::..|..|.....
plant    97 ------------------SFRDEPAKYAQFLE---------------ILNDYSARRVDAPSAVAR 128

  Fly   523 LSELSPHGGAGGGPGAGAAQHNLHHIQQAHQSILLG-----ETGQ-QNQPVEFN-------HAIT 574
            ::||                      .:.|::::||     .||. :..|:|..       ....
plant   129 MTEL----------------------MKDHRNLVLGFSVLLSTGDTKTTPLEAEPDNNKRIRVAN 171

  Fly   575 YVNKIKNRFQ-NQPAKYKKFLEILHDYQREQKVMKEGSLNQGKMLTEQEVYTQVAKLFGQDEDLL 638
            :::|:|.||| |....|:.|||||..||:..|     |:|        ::|.:|..|....|||:
plant   172 FISKLKARFQGNDGHVYESFLEILTMYQQGNK-----SVN--------DLYQEVVALLQGHEDLV 223

  Fly   639 REFGQFLPDATNHQSGQYMSKSA 661
            .||.......|    |...||||
plant   224 MEFSNVFKRTT----GPSGSKSA 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sin3ANP_001246282.1 Sin3 238..1719 CDD:227889 80/413 (19%)
PAH 291..335 CDD:280780 15/43 (35%)
PAH 588..645 CDD:280780 19/56 (34%)
PAH 936..980 CDD:280780
Sin3_corepress 1034..1133 CDD:285494
Sin3a_C 1502..>1710 CDD:293484
AT1G24230NP_173833.1 PAH 32..76 CDD:280780 15/43 (35%)
PAH 103..147 CDD:280780 10/80 (13%)
PAH 186..230 CDD:280780 19/56 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5602
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D253485at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12346
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.