powered by:
Protein Alignment Sin3A and AT1G24210
DIOPT Version :9
Sequence 1: | NP_001246282.1 |
Gene: | Sin3A / 36382 |
FlyBaseID: | FBgn0022764 |
Length: | 2066 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_564212.1 |
Gene: | AT1G24210 / 839035 |
AraportID: | AT1G24210 |
Length: | 155 |
Species: | Arabidopsis thaliana |
Alignment Length: | 71 |
Identity: | 28/71 - (39%) |
Similarity: | 41/71 - (57%) |
Gaps: | 0/71 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 267 TPRLKVEDALSYLDQVKYQYADQPQIYNNFLDIMKEFKSHCIDTPGVIERVSTLFKGHTELIYGF 331
:|.|..:||.||:..||..:.|:|..|..|:.::.....|.:|...||.||..|.|.|.:|:.||
plant 7 SPALTKDDAHSYIIAVKETFHDEPTKYQEFIKLLNGVCDHRVDKYSVIARVEELMKDHQDLLLGF 71
Fly 332 NMFLPP 337
::||||
plant 72 SVFLPP 77
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5602 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D253485at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.820 |
|
Return to query results.
Submit another query.