DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sin3A and AT1G24210

DIOPT Version :9

Sequence 1:NP_001246282.1 Gene:Sin3A / 36382 FlyBaseID:FBgn0022764 Length:2066 Species:Drosophila melanogaster
Sequence 2:NP_564212.1 Gene:AT1G24210 / 839035 AraportID:AT1G24210 Length:155 Species:Arabidopsis thaliana


Alignment Length:71 Identity:28/71 - (39%)
Similarity:41/71 - (57%) Gaps:0/71 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   267 TPRLKVEDALSYLDQVKYQYADQPQIYNNFLDIMKEFKSHCIDTPGVIERVSTLFKGHTELIYGF 331
            :|.|..:||.||:..||..:.|:|..|..|:.::.....|.:|...||.||..|.|.|.:|:.||
plant     7 SPALTKDDAHSYIIAVKETFHDEPTKYQEFIKLLNGVCDHRVDKYSVIARVEELMKDHQDLLLGF 71

  Fly   332 NMFLPP 337
            ::||||
plant    72 SVFLPP 77

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sin3ANP_001246282.1 Sin3 238..1719 CDD:227889 28/71 (39%)
PAH 291..335 CDD:280780 14/43 (33%)
PAH 588..645 CDD:280780
PAH 936..980 CDD:280780
Sin3_corepress 1034..1133 CDD:285494
Sin3a_C 1502..>1710 CDD:293484
AT1G24210NP_564212.1 PAH 32..75 CDD:396992 14/42 (33%)
PAH 105..141 CDD:396992
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5602
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D253485at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.