powered by:
Protein Alignment Sin3A and AT1G10250
DIOPT Version :9
Sequence 1: | NP_001246282.1 |
Gene: | Sin3A / 36382 |
FlyBaseID: | FBgn0022764 |
Length: | 2066 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_172496.1 |
Gene: | AT1G10250 / 837564 |
AraportID: | AT1G10250 |
Length: | 77 |
Species: | Arabidopsis thaliana |
Alignment Length: | 69 |
Identity: | 28/69 - (40%) |
Similarity: | 41/69 - (59%) |
Gaps: | 1/69 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 1569 LDMLKNVLDGNMDSNT-FEDTMREMFGIYAYISFTLDKVVSNAVRQLQYCVTERAALDCVELFAT 1632
:|.|.|:|||::|.|| |||..|.:||..:|:.|||||:|...|:.|....::......::|.|.
plant 1 MDALYNLLDGSIDDNTKFEDECRAIFGAQSYVLFTLDKLVQKFVKHLHAVASDETDTKLLQLHAY 65
Fly 1633 EQRR 1636
|..|
plant 66 ENYR 69
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5602 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D253485at2759 |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000820 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
5 | 4.820 |
|
Return to query results.
Submit another query.