DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sin3A and AT1G10250

DIOPT Version :9

Sequence 1:NP_001246282.1 Gene:Sin3A / 36382 FlyBaseID:FBgn0022764 Length:2066 Species:Drosophila melanogaster
Sequence 2:NP_172496.1 Gene:AT1G10250 / 837564 AraportID:AT1G10250 Length:77 Species:Arabidopsis thaliana


Alignment Length:69 Identity:28/69 - (40%)
Similarity:41/69 - (59%) Gaps:1/69 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly  1569 LDMLKNVLDGNMDSNT-FEDTMREMFGIYAYISFTLDKVVSNAVRQLQYCVTERAALDCVELFAT 1632
            :|.|.|:|||::|.|| |||..|.:||..:|:.|||||:|...|:.|....::......::|.|.
plant     1 MDALYNLLDGSIDDNTKFEDECRAIFGAQSYVLFTLDKLVQKFVKHLHAVASDETDTKLLQLHAY 65

  Fly  1633 EQRR 1636
            |..|
plant    66 ENYR 69

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sin3ANP_001246282.1 Sin3 238..1719 CDD:227889 28/69 (41%)
PAH 291..335 CDD:280780
PAH 588..645 CDD:280780
PAH 936..980 CDD:280780
Sin3_corepress 1034..1133 CDD:285494
Sin3a_C 1502..>1710 CDD:293484 28/69 (41%)
AT1G10250NP_172496.1 Sin3a_C <1..>70 CDD:407120 28/69 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5602
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D253485at2759
OrthoFinder 1 1.000 - - FOG0000820
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.