DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sin3A and AT5G15040

DIOPT Version :9

Sequence 1:NP_001246282.1 Gene:Sin3A / 36382 FlyBaseID:FBgn0022764 Length:2066 Species:Drosophila melanogaster
Sequence 2:NP_001318564.1 Gene:AT5G15040 / 831356 AraportID:AT5G15040 Length:87 Species:Arabidopsis thaliana


Alignment Length:70 Identity:28/70 - (40%)
Similarity:40/70 - (57%) Gaps:0/70 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   277 SYLDQVKYQYADQPQIYNNFLDIMKEFKSHCIDTPGVIERVSTLFKGHTELIYGFNMFLPPGYKI 341
            :|..:||..:.||.:.|:.|.:|:.:.|:..|.......::..|||.|.|||.|||.|||.||||
plant     6 AYFMEVKDTFHDQIEKYDMFKNILLDLKARRIGRHTAFAQLKELFKEHNELIIGFNTFLPTGYKI 70

  Fly   342 EIHSD 346
            .:..|
plant    71 ALDDD 75

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sin3ANP_001246282.1 Sin3 238..1719 CDD:227889 28/70 (40%)
PAH 291..335 CDD:280780 15/43 (35%)
PAH 588..645 CDD:280780
PAH 936..980 CDD:280780
Sin3_corepress 1034..1133 CDD:285494
Sin3a_C 1502..>1710 CDD:293484
AT5G15040NP_001318564.1 PAH 20..64 CDD:396992 15/43 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5602
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D253485at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.