DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sin3A and AT5G15030

DIOPT Version :9

Sequence 1:NP_001246282.1 Gene:Sin3A / 36382 FlyBaseID:FBgn0022764 Length:2066 Species:Drosophila melanogaster
Sequence 2:NP_001190312.2 Gene:AT5G15030 / 831355 AraportID:AT5G15030 Length:139 Species:Arabidopsis thaliana


Alignment Length:137 Identity:47/137 - (34%)
Similarity:60/137 - (43%) Gaps:17/137 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   220 GNLATISQQQPVQQSPLGKAQTPPSSVVANSIPVGGT-------TPPQGQSGNATPRLKVEDALS 277
            |...|||....|..|.....:||...||..|...||.       .|..|        :.:.||.:
plant     3 GYFITISLIVDVLISHEETERTPDEIVVPRSPRHGGNIERSIYLDPSLG--------MTISDARA 59

  Fly   278 YLDQVKYQYADQPQ--IYNNFLDIMKEFKSHCIDTPGVIERVSTLFKGHTELIYGFNMFLPPGYK 340
            ||.|||..:.|..:  .|..|..::.:||:..||...:..|:..|||.|..||.|||.||..|.|
plant    60 YLQQVKNTFIDHDERDKYAMFRKVLFDFKAQRIDRSILYARLKKLFKKHKHLIIGFNTFLSLGDK 124

  Fly   341 IEIHSDA 347
            |.:|.||
plant   125 IFLHGDA 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sin3ANP_001246282.1 Sin3 238..1719 CDD:227889 41/119 (34%)
PAH 291..335 CDD:280780 16/45 (36%)
PAH 588..645 CDD:280780
PAH 936..980 CDD:280780
Sin3_corepress 1034..1133 CDD:285494
Sin3a_C 1502..>1710 CDD:293484
AT5G15030NP_001190312.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5602
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.