DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sin3A and AT3G28870

DIOPT Version :9

Sequence 1:NP_001246282.1 Gene:Sin3A / 36382 FlyBaseID:FBgn0022764 Length:2066 Species:Drosophila melanogaster
Sequence 2:NP_189529.1 Gene:AT3G28870 / 822521 AraportID:AT3G28870 Length:355 Species:Arabidopsis thaliana


Alignment Length:158 Identity:39/158 - (24%)
Similarity:73/158 - (46%) Gaps:28/158 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly  1056 TALCREVLNDKWVSFPTWASEDSTFVTSRK--TQFEETIYRNIHRTEDERFELDLVIEVNSATIR 1118
            |.||:::.:.  :::.....|..|.|...|  |..||.:|    :.|||.||:|:::.|.::.:.
plant   116 TNLCKDLKSQ--IAYGDKEDEAVTRVKGHKNLTDIEEDMY----KWEDEMFEVDMLMRVLTSAVE 174

  Fly  1119 VLENLQKKMSRMSTEEL-SKFHLDDHLGGTSQTIHQRAIHRIYGDKSGEIITGMKKNPFVAVPIV 1182
            ..:.:.|  ..|..::| :||:              |.:..:||:...|.:|...:.   |:|::
plant   175 SAKEVIK--GEMELKDLGAKFY--------------RCVEMLYGEDMFETVTEDHQR---ALPMI 220

  Fly  1183 LKRLKVKEEEWREAQKTFNKQWREQNEK 1210
            |.|||.|......|::.....|::..||
plant   221 LSRLKQKLRHVTTARERLKPLWKQTIEK 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sin3ANP_001246282.1 Sin3 238..1719 CDD:227889 39/158 (25%)
PAH 291..335 CDD:280780
PAH 588..645 CDD:280780
PAH 936..980 CDD:280780
Sin3_corepress 1034..1133 CDD:285494 20/78 (26%)
Sin3a_C 1502..>1710 CDD:293484
AT3G28870NP_189529.1 Sec63 8..342 CDD:214946 39/158 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5602
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12346
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.