DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ak6 and zgc:86811

DIOPT Version :9

Sequence 1:NP_610797.1 Gene:Ak6 / 36379 FlyBaseID:FBgn0033754 Length:175 Species:Drosophila melanogaster
Sequence 2:NP_001002118.1 Gene:zgc:86811 / 415208 ZFINID:ZDB-GENE-040625-113 Length:171 Species:Danio rerio


Alignment Length:166 Identity:77/166 - (46%)
Similarity:109/166 - (65%) Gaps:0/166 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 KPNILITGTPGAGKSYLCERIASELKFEWLDCSKIAKEKNFVEEYDEEYDCPILDEEKLMDHLEP 73
            :||||:|||||.||:.|.:.:|......:::...:|:|....:.:||||.||||||::::|.||.
Zfish     3 RPNILLTGTPGVGKTTLGKELAQRTGLTYVNVGDLAQEAELFDGFDEEYQCPILDEDRVVDELED 67

  Fly    74 LMAKGGNVVEYHGCDFFPERWFQAVFVVTCPNTTLYDRLKERNYNEKKLASNIQCEIFGTILEEA 138
            .|..||.:::||||||||||||..|||:...||.||:||:.|.|..|||..|:|||||.||.|||
Zfish    68 QMGDGGVIIDYHGCDFFPERWFHIVFVLRTDNTNLYNRLESRGYTGKKLQDNVQCEIFQTIFEEA 132

  Fly   139 RDSYKSDIVFELKGETKADAHISIKTVKNWYRMWKR 174
            .::||.:||.:|...|..|...:::.:..|...|.:
Zfish   133 VEAYKEEIVHQLPSNTPEDLERNLEQIVQWIEQWMK 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ak6NP_610797.1 Fap7 10..173 CDD:224847 76/162 (47%)
zgc:86811NP_001002118.1 Fap7 4..169 CDD:224847 77/165 (47%)
AroK 4..168 CDD:223775 77/163 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170594986
Domainoid 1 1.000 140 1.000 Domainoid score I4729
eggNOG 1 0.900 - - E1_COG1936
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5540
Inparanoid 1 1.050 175 1.000 Inparanoid score I4050
OMA 1 1.010 - - QHG62155
OrthoDB 1 1.010 - - D1488235at2759
OrthoFinder 1 1.000 - - FOG0005161
OrthoInspector 1 1.000 - - oto40891
orthoMCL 1 0.900 - - OOG6_101453
Panther 1 1.100 - - LDO PTHR12595
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R631
SonicParanoid 1 1.000 - - X3679
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.