DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ak6 and E02H1.6

DIOPT Version :9

Sequence 1:NP_610797.1 Gene:Ak6 / 36379 FlyBaseID:FBgn0033754 Length:175 Species:Drosophila melanogaster
Sequence 2:NP_001379068.1 Gene:E02H1.6 / 174511 WormBaseID:WBGene00008458 Length:182 Species:Caenorhabditis elegans


Alignment Length:180 Identity:85/180 - (47%)
Similarity:122/180 - (67%) Gaps:9/180 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSEPEPDVKPNILITGTPGAGKSYLCERIASELKFEWLDCSKIAKEKNFVEEYDEEYDCPILDEE 65
            |:.||...:||||:||:||.|||.|.:::|.:|.|.:::.||..:|.|...::||:|:|.:|||:
 Worm     1 MATPETRRRPNILVTGSPGTGKSTLGQQVAEKLGFVFIEVSKEVRENNLQGDFDEQYNCHVLDED 65

  Fly    66 KLMDHLEPLM--AKGGNVVEYHGCDFFPERWFQAVFVVTCPNTTLYDRLKERNYNEKKLASNIQC 128
            ||:||:...:  .:||.||:|||||.||||||..|.|:.||...|||||:.|.|:|.|:..|::|
 Worm    66 KLLDHISDRLDSDEGGIVVDYHGCDLFPERWFDVVVVLRCPTEKLYDRLQSRGYSEFKIKENVEC 130

  Fly   129 EIFGTILEEARDSYKSDIVFELKGETKADAHISIKTV-------KNWYRM 171
            |||||:|||||:||..|||.||:.||......:::.:       ||.:.|
 Worm   131 EIFGTLLEEARESYSEDIVHELQSETTEQMEENLERICELAGEFKNEHTM 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ak6NP_610797.1 Fap7 10..173 CDD:224847 82/171 (48%)
E02H1.6NP_001379068.1 Fap7 10..178 CDD:224847 81/167 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166552
Domainoid 1 1.000 138 1.000 Domainoid score I2992
eggNOG 1 0.900 - - E1_COG1936
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5540
Inparanoid 1 1.050 180 1.000 Inparanoid score I2665
Isobase 1 0.950 - 0 Normalized mean entropy S12178
OMA 1 1.010 - - QHG62155
OrthoDB 1 1.010 - - D1488235at2759
OrthoFinder 1 1.000 - - FOG0005161
OrthoInspector 1 1.000 - - oto17940
orthoMCL 1 0.900 - - OOG6_101453
Panther 1 1.100 - - LDO PTHR12595
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R631
SonicParanoid 1 1.000 - - X3679
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1615.790

Return to query results.
Submit another query.