DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ak6 and Ak6

DIOPT Version :9

Sequence 1:NP_610797.1 Gene:Ak6 / 36379 FlyBaseID:FBgn0033754 Length:175 Species:Drosophila melanogaster
Sequence 2:NP_081868.1 Gene:Ak6 / 102216272 MGIID:5510732 Length:172 Species:Mus musculus


Alignment Length:163 Identity:80/163 - (49%)
Similarity:105/163 - (64%) Gaps:0/163 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 PNILITGTPGAGKSYLCERIASELKFEWLDCSKIAKEKNFVEEYDEEYDCPILDEEKLMDHLEPL 74
            ||||:|||||.||:.|.:.:||....::::...:|:|....:.|||||.||||||::::|.||..
Mouse     4 PNILLTGTPGVGKTTLGKELASRSGLKYVNVGDLAREGQLYDGYDEEYGCPILDEDRVVDELEHQ 68

  Fly    75 MAKGGNVVEYHGCDFFPERWFQAVFVVTCPNTTLYDRLKERNYNEKKLASNIQCEIFGTILEEAR 139
            |.:||.:|:||||||||||||..|||:...|..||.||:.|.||||||..|||||||..:.|||.
Mouse    69 MQEGGVIVDYHGCDFFPERWFHIVFVLRTDNGVLYKRLETRGYNEKKLQDNIQCEIFQVLYEEAI 133

  Fly   140 DSYKSDIVFELKGETKADAHISIKTVKNWYRMW 172
            .|||.:||.:|..........:|..:..|...|
Mouse   134 ASYKEEIVHQLPSNEPEQLEDNINQISKWIEQW 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ak6NP_610797.1 Fap7 10..173 CDD:224847 80/163 (49%)
Ak6NP_081868.1 Fap7 4..170 CDD:224847 80/163 (49%)
NMP. /evidence=ECO:0000255|HAMAP-Rule:MF_03173 33..56 9/22 (41%)
LID. /evidence=ECO:0000255|HAMAP-Rule:MF_03173 108..118 7/9 (78%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 145 1.000 Domainoid score I4563
eggNOG 1 0.900 - - E1_COG1936
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5540
Inparanoid 1 1.050 173 1.000 Inparanoid score I4077
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG62155
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005161
OrthoInspector 1 1.000 - - oto93768
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR12595
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R631
SonicParanoid 1 1.000 - - X3679
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.960

Return to query results.
Submit another query.