DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ak6 and AK6

DIOPT Version :9

Sequence 1:NP_610797.1 Gene:Ak6 / 36379 FlyBaseID:FBgn0033754 Length:175 Species:Drosophila melanogaster
Sequence 2:NP_057367.1 Gene:AK6 / 102157402 HGNCID:49151 Length:172 Species:Homo sapiens


Alignment Length:163 Identity:78/163 - (47%)
Similarity:109/163 - (66%) Gaps:0/163 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 PNILITGTPGAGKSYLCERIASELKFEWLDCSKIAKEKNFVEEYDEEYDCPILDEEKLMDHLEPL 74
            ||||:|||||.||:.|.:.:||:...::::...:|:|:...:.||||||||||||::::|.|:..
Human     4 PNILLTGTPGVGKTTLGKELASKSGLKYINVGDLAREEQLYDGYDEEYDCPILDEDRVVDELDNQ 68

  Fly    75 MAKGGNVVEYHGCDFFPERWFQAVFVVTCPNTTLYDRLKERNYNEKKLASNIQCEIFGTILEEAR 139
            |.:||.:|:||||||||||||..|||:......||:||:.|.||||||..|||||||..:.|||.
Human    69 MREGGVIVDYHGCDFFPERWFHIVFVLRTDTNVLYERLETRGYNEKKLTDNIQCEIFQVLYEEAT 133

  Fly   140 DSYKSDIVFELKGETKADAHISIKTVKNWYRMW 172
            .|||.:||.:|......:...::..:..|...|
Human   134 ASYKEEIVHQLPSNKPEELENNVDQILKWIEQW 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ak6NP_610797.1 Fap7 10..173 CDD:224847 78/163 (48%)
AK6NP_057367.1 Fap7 4..170 CDD:224847 78/163 (48%)
NMP 33..56 10/22 (45%)
LID 108..118 7/9 (78%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159002
Domainoid 1 1.000 149 1.000 Domainoid score I4456
eggNOG 1 0.900 - - E1_COG1936
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5540
Inparanoid 1 1.050 175 1.000 Inparanoid score I4056
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG62155
OrthoDB 1 1.010 - - D1488235at2759
OrthoFinder 1 1.000 - - FOG0005161
OrthoInspector 1 1.000 - - oto90192
orthoMCL 1 0.900 - - OOG6_101453
Panther 1 1.100 - - LDO PTHR12595
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R631
SonicParanoid 1 1.000 - - X3679
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1514.840

Return to query results.
Submit another query.