DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp301a1 and CYP724A1

DIOPT Version :9

Sequence 1:NP_610796.1 Gene:Cyp301a1 / 36378 FlyBaseID:FBgn0033753 Length:553 Species:Drosophila melanogaster
Sequence 2:NP_001331288.1 Gene:CYP724A1 / 831291 AraportID:AT5G14400 Length:421 Species:Arabidopsis thaliana


Alignment Length:339 Identity:69/339 - (20%)
Similarity:141/339 - (41%) Gaps:67/339 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   212 DFLVRCENL----LDENQELPE-DFDNEIHKWSLECIGRVALDTRLGCLESNLKPDSEPQQIIDA 271
            |||...|||    |...:...| :|..|:..::|..:....|         ::||: :|.::   
plant   109 DFLHCAENLSISILKSWKNCREVEFHKEVKIFTLSVMVNQLL---------SIKPE-DPARL--- 160

  Fly   272 AKYALRNVATLELKAPYWRYF---PTPL----WTRYVKNMNFFVGVCMKYIQSATERLKTQDPSL 329
              |.|::..:      |.:.|   |.||    :|..:|.........|..|:......:..:.::
plant   161 --YVLQDFLS------YMKGFISLPIPLPGTGYTNAIKARKRLSARVMGMIKEREREEEDMNNAI 217

  Fly   330 RAGEPSLVEKVILSQK---DEKIATIMALDLILVGIDTISMAVCSMLYQLATRPVDQQKVHEELK 391
            |  |...::.:|.::.   :||::.:  ||::|.|.:|.:..:..::|.||..|....|:.||..
plant   218 R--EEDFLDSIISNEDLNYEEKVSIV--LDILLGGFETSATTLSLVVYFLAKSPNLLHKLKEEHA 278

  Fly   392 RLLPDPNTPLTIPLLDQMHHLKGFIKEVFRMYSTVIGNGRTLMEDSVICGYQVPKGVQAVFPTIV 456
            .:......       .::.:.:.:.|..|.         :.::.:::.|.|.:|||.: |||...
plant   279 AIRAKKGD-------GELLNWEDYQKMEFT---------QCVISEALRCEYVIPKGWK-VFPIFT 326

  Fly   457 TGNMEEYV-TDAATFRPERWLKPQHGGTPGKLHPFASLPYGYGARMCLGRRFADLEMQILLAKLL 520
            ..:::..: .:...|.|.||.      ...|::. .:..:|.|.|:|.|.....|::...|..|:
plant   327 AVHLDPSLHENPFEFNPMRWT------DKAKMNK-KTTAFGGGVRVCPGGELGKLQIAFFLHHLV 384

  Fly   521 RNY--KLEYNHKPL 532
            .:|  |::.:..|:
plant   385 LSYRWKIKSDEMPI 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp301a1NP_610796.1 p450 76..530 CDD:299894 68/335 (20%)
CYP724A1NP_001331288.1 cytochrome_P450 28..415 CDD:425388 69/339 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D871849at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.