DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp301a1 and Cyp313a3

DIOPT Version :9

Sequence 1:NP_610796.1 Gene:Cyp301a1 / 36378 FlyBaseID:FBgn0033753 Length:553 Species:Drosophila melanogaster
Sequence 2:NP_650170.2 Gene:Cyp313a3 / 41488 FlyBaseID:FBgn0038007 Length:492 Species:Drosophila melanogaster


Alignment Length:497 Identity:112/497 - (22%)
Similarity:206/497 - (41%) Gaps:91/497 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 QIPGPKPIPILGNTWRLMPIIGQYTISDVAKISSLLHDRYGRIVRFGGLIGRPDLLFIYDADEIE 138
            :||||..:||||       |..:|.|:...|:|  :..:|               :.||.:    
  Fly    31 KIPGPMGLPILG-------IAFEYLITYKRKMS--IRTKY---------------MDIYGS---- 67

  Fly   139 KCYRSEGPTPF----RPSM-------PSLVKYKSVVRKDFFGDLG-GVVGVHGEPWREFRSRVQK 191
            .|....|||||    .|.:       |..:...|:..|......| |::.:....|.:.|..: .
  Fly    68 TCLVWVGPTPFVITRDPKIAEEIFLSPECLNRSSIFSKPVNSCTGDGLLSLEASKWVDRRKNL-N 131

  Fly   192 PVLQLSTIRRYLQPLEVITEDFLVRCENLLDENQELPEDFDNEIHKWSLECIGRVALDTRLGC-- 254
            |..:.:.:..:|.......:..:...::|:.:.::...|   :|.:||.    |:|..|.:|.  
  Fly   132 PAFKQNVLLSFLPIFNSEAKTLVAFLDSLVGQGEKKVRD---DIVRWSF----RIATQTTVGTDV 189

  Fly   255 -LESNLKPDSEPQQIIDAAKYALRNVATLELKAPYWRYFPTPLWTRYVK-----NMNFFVGVCMK 313
             .:::.|.||..:......|..:.||.   |...:.:.|.|.......|     |:|..:|..: 
  Fly   190 KKDASFKNDSVLKSYETFMKIIVMNVL---LPFTHNKIFSTLGGFETQKALAKSNVNKMIGTIV- 250

  Fly   314 YIQSATERLKTQDPSLRAGEP---SLVEKVILSQKD-----EKIATIMALDLILVGIDTISMAVC 370
                 .::|.|:..|  ..:|   |::.|.|...::     |::.: .....::...:|....|.
  Fly   251 -----DKKLMTKPES--GSQPEITSVINKAIELHRNGEMSREEVQS-ECCSFVVAAFETTGDTVY 307

  Fly   371 SMLYQLATRPVDQQKVHEELKRLLP-DPNTPLTIPLLDQMHHLKGFIKEVFRMYSTVIGNGR-TL 433
            ..|..||..|..|..|::|||.|.| ..:..:|...|.:|..|:..:.|..|:..:|....| |:
  Fly   308 HALILLAMFPEHQDTVYQELKELFPVAGDFEVTYDDLQRMVFLERVVNETLRLIPSVPFTPRETI 372

  Fly   434 MEDSVICGYQVPKGVQAVFPTIVT-GNMEEYVTDAATFRPERWLKPQHGGTPGKL---HPFASLP 494
            .:..:..|..:||||........| .|.:.:.||.::|.|:.:|       |..:   ||:|.:|
  Fly   373 RDFRLSSGVVIPKGVGIGIDIFATHRNRDHWGTDPSSFNPDHFL-------PDNVRDRHPYAYIP 430

  Fly   495 YGYGARMCLGRRFADLEMQILLAKLLRNYKL--EYNHKPLDY 534
            :..|.|.|:|.::..:..::.|:|:|||.|:  .:.::.|::
  Fly   431 FSKGRRNCIGWKYGLMSSKLALSKILRNCKVSTSFRYEDLEF 472

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp301a1NP_610796.1 p450 76..530 CDD:299894 110/489 (22%)
Cyp313a3NP_650170.2 p450 33..463 CDD:299894 110/484 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24305
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.