DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp301a1 and Cyp28a5

DIOPT Version :9

Sequence 1:NP_610796.1 Gene:Cyp301a1 / 36378 FlyBaseID:FBgn0033753 Length:553 Species:Drosophila melanogaster
Sequence 2:NP_609694.1 Gene:Cyp28a5 / 34817 FlyBaseID:FBgn0028940 Length:505 Species:Drosophila melanogaster


Alignment Length:508 Identity:105/508 - (20%)
Similarity:189/508 - (37%) Gaps:113/508 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 IPGPKPIPILGNTWRLMPIIGQYTISDVAKISSLLHDRYGRIVRFGGLIGRPDLLFIYDADEIEK 139
            :|||||..:.|| :..|..:.::.|.|:..|.....::|..:..||.  ..|.||.|        
  Fly    32 VPGPKPKLLCGN-YPNMFTMKRHAIYDLDDIYRQYKNKYDAVGIFGS--RSPQLLVI-------- 85

  Fly   140 CYRSEGPTPFRPSMPSLVK-------YKSVVRKDFFGDLGGVVGVHGEPWREFRSRVQKPVLQLS 197
                 .|...|....|..|       .|::..|..|........:.||.|:..|:.| .|.|.:.
  Fly    86 -----NPALARRVFVSNFKNFHDNEIAKNIDEKTDFIFANNPFSLTGEKWKTRRADV-TPGLTMG 144

  Fly   198 TIRRYLQPLEVITEDFLVRCENLLDENQELPEDFDNEIHKWSLECIGRVALDTRLGCLESNLKPD 262
            .|:........:       |:.|.:               |       |....|||..:.     
  Fly   145 RIKTVYPVTNKV-------CQKLTE---------------W-------VEKQLRLGSKDG----- 175

  Fly   263 SEPQQIIDAAKYAL---RNVAT---LELKAPYWRYFPTPLWTRYVKNMN-------FFV------ 308
                  |||...:|   ..:.|   |.|.|..:...|||:.::.....|       ||:      
  Fly   176 ------IDAKHMSLCFTTEMVTDCVLGLGAESFSDKPTPIMSKINDLFNQPWTFVLFFILTSSFP 234

  Fly   309 ----GVCMKYIQSATER---------LKTQDPSLRAGE----PSLVEKVI-LSQK---DEKIATI 352
                .:.::::....||         ::|:...|.||:    ...::.:: |.:|   |.:....
  Fly   235 SLSHLIKLRFVPVDVERFFVDLMGSAVETRRAQLAAGKQFERSDFLDYILQLGEKRNLDNRQLLA 299

  Fly   353 MALDLILVGIDTISMAVCSMLYQLATRPVDQQKVHEELKRLLPDPNTPLTIPLLDQMHHLKGFIK 417
            .::..:|.|.:|.:..:..:|..|......|..:.||::..|.|..  :....|..:.:|...::
  Fly   300 YSMTFLLDGFETTATVLAHILLNLGRNKEAQNLLREEIRSHLQDGT--IAFEKLSDLPYLDACVQ 362

  Fly   418 EVFRMYSTVIGNGRTLMEDSVI-----CGYQVPKGVQAVFPTIVTGNMEEYVTDAATFRPERWLK 477
            |..|::.....:.:...|...|     ..:.|.||...|.|.......||:..:..:|:|||:|:
  Fly   363 ETIRLFPPGFMSNKLCTESIEIPNKEGPNFVVEKGTTVVVPHYCFMLDEEFFPNPQSFQPERFLE 427

  Fly   478 PQHGGTPGKLHPFASLPYGYGARMCLGRRFADLEMQILLAKLLRNYKLEYNHK 530
            |....|..:...|  :.:|.|.|:|:|.|||.::::..:.:|:..:.::.|.|
  Fly   428 PDAAKTFRERGVF--MGFGDGPRVCIGMRFATVQIKAAIVELISKFNVKINDK 478

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp301a1NP_610796.1 p450 76..530 CDD:299894 104/505 (21%)
Cyp28a5NP_609694.1 p450 33..500 CDD:299894 105/507 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.