DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment fra and Palldl1

DIOPT Version :9

Sequence 1:	NP_523716.2	Gene:	fra / 36377	FlyBaseID:	FBgn0011592	Length:	1526	Species:	Drosophila melanogaster
Sequence 2:	XP_038951103.1	Gene:	Palldl1 / 364558	RGDID:	1359390	Length:	385	Species:	Rattus norvegicus

Alignment Length:	102	Identity:	28/102 - (27%)
Similarity:	42/102 - (41%)	Gaps:	25/102 - (24%)

- Green bases have known domain annotations that are detailed below.

  Fly   191 LDKLRM---VVLPNGALEIDEVGPSDRGSYQCNVTSGSSSRLSSKT--NLNIKKPSDPGAEN--S 248
            ||:|.|   |..|.|:|           .||.:       :...:|  :.:|..|....|.:  |
  Rat   230 LDQLEMDAEVKQPQGSL-----------CYQAH-------KAPEETLPHTHIPHPQPQKARHLPS 276

  Fly   249 VAPSFLVGPSPKTVREGDTVTLDCVANGVPKPQIKWL 285
            .||.|:.....:.|.||..|.|:|...|.|.|::.:|
  Rat   277 SAPRFIQKLRSQEVAEGSRVYLECRVTGNPAPRVSFL 313

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
fra	NP_523716.2	Ig	36..140	CDD:299845
		Ig	<180..222	CDD:299845	10/33 (30%)
		IG_like	257..340	CDD:214653	10/29 (34%)
		IGc2	264..327	CDD:197706	9/22 (41%)
		I-set	344..430	CDD:254352
		Ig	363..428	CDD:299845
		FN3	611..703	CDD:238020
		FN3	711..799	CDD:238020
		FN3	806..897	CDD:238020
		FN3	908..989	CDD:238020
		FN3	1011..1097	CDD:238020
		FN3	1109..1205	CDD:238020
		Neogenin_C	1273..1521	CDD:284094
Palldl1	XP_038951103.1	Ig	278..>312	CDD:416386	12/33 (36%)
		Ig strand A	278..281	CDD:409353	2/2 (100%)
		Ig strand A'	284..288	CDD:409353	0/3 (0%)
		Ig strand B	296..304	CDD:409353	3/7 (43%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	O	PTHR44170
Phylome	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	1.100