DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fra and zig-3

DIOPT Version :9

Sequence 1:NP_523716.2 Gene:fra / 36377 FlyBaseID:FBgn0011592 Length:1526 Species:Drosophila melanogaster
Sequence 2:NP_509336.1 Gene:zig-3 / 192088 WormBaseID:WBGene00006980 Length:251 Species:Caenorhabditis elegans


Alignment Length:223 Identity:59/223 - (26%)
Similarity:91/223 - (40%) Gaps:53/223 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   312 SAEDIDSGNYQCRASNTVDSLDAQATVQVQEPP-KFIKAPKDTTAHEKDEPELKCDIWGKPKPVI 375
            ||..:.||..:...||.|..:|  :|....:|. |.|:..:|.|....:...|:||:...|..||
 Worm    13 SAHPLSSGEMRAAVSNLVREID--STHLTTKPSLKIIEGLEDNTVSTGESVTLRCDVLSTPTGVI 75

  Fly   376 RWLKNGDLITPNDYMQLVDGHNLKIL---------GLLNSD----------AGMFQCVGTNAAGS 421
            .|.|:|..|..:..:.:.:    |:|         |::.|.          .|.::||.||...:
 Worm    76 YWEKDGQRIQGDKELNVFE----KVLNAMGPTVESGIITSSYQIPCANLHHIGSYKCVATNGHDT 136

  Fly   422 VHAAARLRVVPQGVKIKKRKSQG----HSTKS-LQTFDNL------TKRRKPFNSGEQLRTKSGG 475
            |.::|::.|..|.||.|..:...    .||:| .:..||.      ..||..:|           
 Worm   137 VESSAKISVEGQTVKCKSTRRSAPVITMSTESRFELQDNAATLICRADRRANWN----------- 190

  Fly   476 SFPFPDEDDDLDDNDSGTTRLRIPSGKL 503
             :.|.|:..|.   |||...| :|||.|
 Worm   191 -WMFEDKKIDF---DSGRYEL-LPSGDL 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fraNP_523716.2 Ig 36..140 CDD:299845
Ig <180..222 CDD:299845
IG_like 257..340 CDD:214653 9/27 (33%)
IGc2 264..327 CDD:197706 4/14 (29%)
I-set 344..430 CDD:254352 25/105 (24%)
Ig 363..428 CDD:299845 21/83 (25%)
FN3 611..703 CDD:238020
FN3 711..799 CDD:238020
FN3 806..897 CDD:238020
FN3 908..989 CDD:238020
FN3 1011..1097 CDD:238020
FN3 1109..1205 CDD:238020
Neogenin_C 1273..1521 CDD:284094
zig-3NP_509336.1 I-set 45..145 CDD:254352 25/103 (24%)
Ig 61..142 CDD:143165 20/84 (24%)
IG_like 177..244 CDD:214653 14/53 (26%)
Ig <191..237 CDD:299845 11/27 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.