DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fra and zig-11

DIOPT Version :9

Sequence 1:NP_523716.2 Gene:fra / 36377 FlyBaseID:FBgn0011592 Length:1526 Species:Drosophila melanogaster
Sequence 2:NP_503523.2 Gene:zig-11 / 189580 WormBaseID:WBGene00021305 Length:304 Species:Caenorhabditis elegans


Alignment Length:266 Identity:59/266 - (22%)
Similarity:94/266 - (35%) Gaps:70/266 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 RTQLKNGSLYISSVEENRGLTGAYQCLLTAEGVGSILSRPALVAIVRQPDLNQDFLETYLLPGQT 160
            :|.:...||:.:.::|||..||...|.:..   |:|..:|.....||..|..|            
 Worm    37 QTVIHGESLFSTDIDENRKTTGVLWCQVRE---GTIHYKPTWARFVRIRDQKQ------------ 86

  Fly   161 AYFRCMLGEANWQEGVKHSVQWLKDDLPLPLDKLRMVVLPNGALEIDEVGPSDRGSYQCNVTSGS 225
              ||..:|              |.||              ...|...:......|.|:|.:....
 Worm    87 --FRADIG--------------LDDD--------------KAYLHFGQSKADASGKYRCEIKVPD 121

  Fly   226 SSRLSSKTNLNIKKPSDPGAENSVA---------PSFLVGPSPKTVREGDTVTLDCVANGVPKPQ 281
            :|.:..    |:...|.|..:|:..         |..:|||:.....: ....:.|...|.|:||
 Worm   122 NSIIIG----NMFAYSHPVVKNNETWELKKSESEPFTVVGPAVYAPLD-SAARIQCPIVGYPEPQ 181

  Fly   282 IKWLRNGMDLDFNDLDSRFSIVGTGSLQISSAEDIDSGNYQCRASNTVDSLDAQATVQVQEPPKF 346
            |.|.::...|   :::.|.... .|.|.|..|::.|:|.|:|.|:|       |..||:..|.:.
 Worm   182 IVWYKDKFPL---EIEGRVKFT-AGVLSIEGAQEEDAGVYRCEATN-------QFPVQIDGPEQH 235

  Fly   347 IKAPKD 352
            .....|
 Worm   236 FAVKLD 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fraNP_523716.2 Ig 36..140 CDD:299845 12/43 (28%)
Ig <180..222 CDD:299845 7/41 (17%)
IG_like 257..340 CDD:214653 22/82 (27%)
IGc2 264..327 CDD:197706 18/62 (29%)
I-set 344..430 CDD:254352 1/9 (11%)
Ig 363..428 CDD:299845
FN3 611..703 CDD:238020
FN3 711..799 CDD:238020
FN3 806..897 CDD:238020
FN3 908..989 CDD:238020
FN3 1011..1097 CDD:238020
FN3 1109..1205 CDD:238020
Neogenin_C 1273..1521 CDD:284094
zig-11NP_503523.2 IGc2 165..223 CDD:197706 18/62 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.