DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fra and AgaP_AGAP008077

DIOPT Version :9

Sequence 1:NP_523716.2 Gene:fra / 36377 FlyBaseID:FBgn0011592 Length:1526 Species:Drosophila melanogaster
Sequence 2:XP_317380.3 Gene:AgaP_AGAP008077 / 1277872 VectorBaseID:AGAP008077 Length:667 Species:Anopheles gambiae


Alignment Length:222 Identity:49/222 - (22%)
Similarity:79/222 - (35%) Gaps:64/222 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   491 SGTTRLRIPSGKLPKFEQPLNDRRFNILNAGSALPLDNQSKSYEDDDDDYDEDDPAKEALLE--- 552
            |.|:.:.||           |..:.::||:| .|.||....|..|:.:...:..|.|...|.   
Mosquito    19 SSTSLVSIP-----------NTIKLSMLNSG-LLSLDKVKLSARDEKNPLSQTMPDKPTELRHFA 71

  Fly   553 -----------AYK-QGEDAHKI-LDSWQQSKSKKSQQQKQSP-ASP--------DSPEQDPSVP 595
                       .|| :.:.|.|: .:|.:.:..|.:..:.|:| ..|        |..:..|...
Mosquito    72 KLCEQRRKFPILYKLEFQTAVKVETNSCKHALRKANALKNQNPKCIPYDYNRVVLDKYDNTPDSD 136

  Fly   596 HPGGKPLDSGLQ--ARLPSQ--PRDLVAQIVKSRFVTLSWVEPLQNAGDVVYYT----------V 646
            :.....:||.|:  |.:.:|  ..|.|..     |..:.|.|   |...:|..|          |
Mosquito   137 YINASYVDSLLKPNAYIVTQGPTEDTVLD-----FWRMVWQE---NCSCIVMLTKTFDFTKVMCV 193

  Fly   647 YYKMNNSEREQKMVTKSHDDQQVNIQS 673
            .|...|.|:|:     .:.|..:.|||
Mosquito   194 QYWPPNKEKEE-----IYGDMHITIQS 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fraNP_523716.2 Ig 36..140 CDD:299845
Ig <180..222 CDD:299845
IG_like 257..340 CDD:214653
IGc2 264..327 CDD:197706
I-set 344..430 CDD:254352
Ig 363..428 CDD:299845
FN3 611..703 CDD:238020 18/75 (24%)
FN3 711..799 CDD:238020
FN3 806..897 CDD:238020
FN3 908..989 CDD:238020
FN3 1011..1097 CDD:238020
FN3 1109..1205 CDD:238020
Neogenin_C 1273..1521 CDD:284094
AgaP_AGAP008077XP_317380.3 PTPc 87..349 CDD:214550 31/142 (22%)
PTPc 110..349 CDD:238006 27/119 (23%)
Y_phosphatase 409..652 CDD:278528
PTPc 411..652 CDD:238006
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.