DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fra and AgaP_AGAP008734

DIOPT Version :9

Sequence 1:NP_523716.2 Gene:fra / 36377 FlyBaseID:FBgn0011592 Length:1526 Species:Drosophila melanogaster
Sequence 2:XP_314848.4 Gene:AgaP_AGAP008734 / 1275587 VectorBaseID:AGAP008734 Length:292 Species:Anopheles gambiae


Alignment Length:388 Identity:80/388 - (20%)
Similarity:127/388 - (32%) Gaps:124/388 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 SSVEENRGLTGAYQCLLTAEGVGSILSRPALVAIVRQPDLNQDFLETYLLPGQTAYFRCMLGEAN 171
            :.|...||.|....|.:.::.       .|||:.:|:    |||  ..|..|...|   ...|..
Mosquito     9 TKVTAQRGGTALLPCTVISQS-------SALVSWIRR----QDF--QLLTVGLATY---SSDERF 57

  Fly   172 WQEGVKHSVQWLKDDLPLPLDKLRMVVLPNGALEIDEVGPSDRGSYQCNVTSGSSSRLSSKTNLN 236
            ..|.::|...|                    ||.|..|...|.|.|:|              .|:
Mosquito    58 LVEHLRHLGHW--------------------ALRIKSVRTEDEGLYEC--------------QLS 88

  Fly   237 IKKPSDPGAENSV--APSFLVGPSPKTVREGDTVTLDC-VANGVPKPQ-IKWLRNGMDLDFNDLD 297
            :........|..|  |.:.:||.....:.||.|:.|:| :.:....|. :.|......::|:.|:
Mosquito    89 VHPVQSVFVELKVVEAVAEIVGAPDLHIDEGSTLRLECKLQSATENPTFVFWYHEQNMVNFDQLN 153

  Fly   298 SRFSIVGTGSLQISSAEDIDSGNYQCRASNTVDSLDAQATVQVQEPPKFIKAPKDTTAHEKDEPE 362
            . ||:                         |.....|.|:......|.....|.:...||.  ||
Mosquito   154 G-FSV-------------------------TPFQPPATASHPSHLHPYLFPHPLEDDQHEL--PE 190

  Fly   363 LKCDIWG-----KPKPVIRWLKNGD-----LITPNDYMQLVDGHNLKILGLLN---SDAGMFQCV 414
            |..:..|     ..:.:.|.||.|.     .:||:....|:    |.:|.:..   ..||.:.|.
Mosquito   191 LSSEEQGYNLLDDDRLLQRSLKLGQDSAEPFLTPSSSSSLL----LAVLTIKEVHLRHAGNYTCA 251

  Fly   415 GTN---AAGSVHAAARLRVVPQGVKIKKRKSQGHSTKSLQTFDNLTKRRKPFNSGEQLRTKSG 474
            .:|   |:.:||       |.||   :|..:..|:.:|            ..:.|.:..::||
Mosquito   252 PSNARPASITVH-------VLQG---EKPAAMQHANRS------------QLDDGSKPSSRSG 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fraNP_523716.2 Ig 36..140 CDD:299845 8/32 (25%)
Ig <180..222 CDD:299845 9/41 (22%)
IG_like 257..340 CDD:214653 14/84 (17%)
IGc2 264..327 CDD:197706 11/64 (17%)
I-set 344..430 CDD:254352 24/101 (24%)
Ig 363..428 CDD:299845 18/80 (23%)
FN3 611..703 CDD:238020
FN3 711..799 CDD:238020
FN3 806..897 CDD:238020
FN3 908..989 CDD:238020
FN3 1011..1097 CDD:238020
FN3 1109..1205 CDD:238020
Neogenin_C 1273..1521 CDD:284094
AgaP_AGAP008734XP_314848.4 V-set 6..102 CDD:284989 29/142 (20%)
IG_like 11..101 CDD:214653 29/139 (21%)
IG_like <233..264 CDD:214653 8/37 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.