DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fra and AgaP_AGAP005028

DIOPT Version :9

Sequence 1:NP_523716.2 Gene:fra / 36377 FlyBaseID:FBgn0011592 Length:1526 Species:Drosophila melanogaster
Sequence 2:XP_313891.4 Gene:AgaP_AGAP005028 / 1274863 VectorBaseID:AGAP005028 Length:115 Species:Anopheles gambiae


Alignment Length:107 Identity:32/107 - (29%)
Similarity:45/107 - (42%) Gaps:13/107 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   254 LVGPSPKTVREGDTVTLDC--VANGVPKPQIKWLRNGMDLDFNDLDSRFSIVGT------GSLQI 310
            :|||..|.:....|:.|.|  |.:......|.|..|...::: |||...: |.|      ..|.|
Mosquito    13 IVGPQVKYLTPDSTLKLICRVVQSTEASAFIFWYHNNRMINY-DLDRGIN-VSTEADFHYSELTI 75

  Fly   311 SSAEDIDSGNYQCRASNTVDSLDAQATVQVQEPPKFIKAPKD 352
            |.|....||||.|..||   |..|...|.:.:....::|.:|
Mosquito    76 SQASKEHSGNYTCVPSN---SQPASVVVHIFKGKVPLQAGRD 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fraNP_523716.2 Ig 36..140 CDD:299845
Ig <180..222 CDD:299845
IG_like 257..340 CDD:214653 28/90 (31%)
IGc2 264..327 CDD:197706 21/70 (30%)
I-set 344..430 CDD:254352 2/9 (22%)
Ig 363..428 CDD:299845
FN3 611..703 CDD:238020
FN3 711..799 CDD:238020
FN3 806..897 CDD:238020
FN3 908..989 CDD:238020
FN3 1011..1097 CDD:238020
FN3 1109..1205 CDD:238020
Neogenin_C 1273..1521 CDD:284094
AgaP_AGAP005028XP_313891.4 IG_like 16..100 CDD:214653 27/88 (31%)
IGc2 23..93 CDD:197706 23/74 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.