DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fra and AgaP_AGAP005069

DIOPT Version :9

Sequence 1:NP_523716.2 Gene:fra / 36377 FlyBaseID:FBgn0011592 Length:1526 Species:Drosophila melanogaster
Sequence 2:XP_313943.4 Gene:AgaP_AGAP005069 / 1274751 VectorBaseID:AGAP005069 Length:354 Species:Anopheles gambiae


Alignment Length:231 Identity:59/231 - (25%)
Similarity:82/231 - (35%) Gaps:56/231 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   257 PSPKTVREGDTVTLDCVANGVPKPQIKWLRNGMDLDFNDL---------DSRFSIV-GTGS---- 307
            |...||..|.|..|.|....:....:.|:|.   .|.:.|         |.||.:: ..||    
Mosquito    49 PRNITVTVGQTGFLHCRVERLGDKDVAWIRK---RDIHILTTGASTYTSDQRFQVLHPEGSVNWT 110

  Fly   308 LQISSAEDIDSGNYQCRASNTVDSLDAQATVQVQEPPKFIKAPKDTTAHEKDEPELKCDIWGKPK 372
            |||...:..|:|.|:|:. ||...:....|:.|.|....|..|.|.......|..:.|.|...|.
Mosquito   111 LQIKYPQVRDTGVYECQI-NTEPKMSLSYTLNVIELRARILGPTDIFVKSDSEITMTCVIQQGPH 174

  Fly   373 PV--IRWLKNGDLITP------------------NDYMQLVDGHNLKILGLLNSDAGMFQCVGTN 417
            .:  |.|.|...||.|                  .|:..::.. .|||..::.||.|.:.||.|.
Mosquito   175 ELGTIFWYKGSTLIEPLAQENELLPSEKRRIIVETDWTDVLTS-RLKIKRVVQSDTGNYTCVPTM 238

  Fly   418 AAGSVHAAARLRVVPQGVKIKKRKSQGHSTKSLQTF 453
            |..   |:....|:              |.|.:|||
Mosquito   239 AKS---ASVCAHVI--------------SGKFVQTF 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fraNP_523716.2 Ig 36..140 CDD:299845
Ig <180..222 CDD:299845
IG_like 257..340 CDD:214653 26/96 (27%)
IGc2 264..327 CDD:197706 20/76 (26%)
I-set 344..430 CDD:254352 25/105 (24%)
Ig 363..428 CDD:299845 21/84 (25%)
FN3 611..703 CDD:238020
FN3 711..799 CDD:238020
FN3 806..897 CDD:238020
FN3 908..989 CDD:238020
FN3 1011..1097 CDD:238020
FN3 1109..1205 CDD:238020
Neogenin_C 1273..1521 CDD:284094
AgaP_AGAP005069XP_313943.4 Ig 48..142 CDD:299845 26/96 (27%)
IG_like 49..142 CDD:214653 26/96 (27%)
I-set 152..249 CDD:254352 24/100 (24%)
Ig 163..235 CDD:143165 16/72 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.