DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fra and AgaP_AGAP012441

DIOPT Version :9

Sequence 1:NP_523716.2 Gene:fra / 36377 FlyBaseID:FBgn0011592 Length:1526 Species:Drosophila melanogaster
Sequence 2:XP_313213.4 Gene:AgaP_AGAP012441 / 1274136 VectorBaseID:AGAP012441 Length:268 Species:Anopheles gambiae


Alignment Length:267 Identity:57/267 - (21%)
Similarity:82/267 - (30%) Gaps:109/267 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   152 ETYLLP----GQTAYFRCMLGEANWQEGVKHSVQWL--KDDLPLPL--------DKLRMVVLPNG 202
            |.|.|.    |.||:..|.:....  |||   |.|:  ||...|.:        ::.....|.|.
Mosquito     8 ENYTLVTSQIGSTAHVPCRIHHIG--EGV---VSWIRRKDYHLLTVGLTTYSSDERFSATHLQNS 67

  Fly   203 ---ALEIDEVGPSDRGSYQCNVTSGSSSRLSSKTNLNIK-KPSDPGAENSVAPSFLVGPSPKTVR 263
               .|:|..|...|.|.|:|.|::      ...|::.:: |..:..||       :|||..|.:.
Mosquito    68 EDWTLQIKFVQDRDAGLYECQVST------HPPTSIFLELKVVEARAE-------IVGPQVKYLT 119

  Fly   264 EGDTVTLDC--VANGVPKPQIKWLRNGMDLDFNDLDSRFSI------------------------ 302
            ...|:.|.|  |.:......|.|..|...::: |||...::                        
Mosquito   120 PDSTLKLICRVVQSTEASAFIFWYHNNRMINY-DLDRGINVSTEAEETTVQFGMRFLFDTISNIM 183

  Fly   303 ----------------------VGTGSLQ------------------------ISSAEDIDSGNY 321
                                  .||.||.                        ||.|....||||
Mosquito   184 LRSQADGVSSCLFRSGFGQHVAYGTESLHVYGLYSTPLSQPLALKDFHYSELTISQASKEHSGNY 248

  Fly   322 QCRASNT 328
            .|..||:
Mosquito   249 TCVPSNS 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fraNP_523716.2 Ig 36..140 CDD:299845
Ig <180..222 CDD:299845 14/54 (26%)
IG_like 257..340 CDD:214653 26/144 (18%)
IGc2 264..327 CDD:197706 22/134 (16%)
I-set 344..430 CDD:254352
Ig 363..428 CDD:299845
FN3 611..703 CDD:238020
FN3 711..799 CDD:238020
FN3 806..897 CDD:238020
FN3 908..989 CDD:238020
FN3 1011..1097 CDD:238020
FN3 1109..1205 CDD:238020
Neogenin_C 1273..1521 CDD:284094
AgaP_AGAP012441XP_313213.4 Ig 13..94 CDD:299845 22/91 (24%)
IG_like 13..90 CDD:214653 21/81 (26%)
Ig <233..255 CDD:299845 9/21 (43%)
IG_like <233..255 CDD:214653 9/21 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.