DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fra and AgaP_AGAP002708

DIOPT Version :9

Sequence 1:NP_523716.2 Gene:fra / 36377 FlyBaseID:FBgn0011592 Length:1526 Species:Drosophila melanogaster
Sequence 2:XP_312220.4 Gene:AgaP_AGAP002708 / 1273260 VectorBaseID:AGAP002708 Length:382 Species:Anopheles gambiae


Alignment Length:336 Identity:71/336 - (21%)
Similarity:112/336 - (33%) Gaps:126/336 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   161 AYFRCMLGEANWQEGVKHSVQWLK---DDLPL-----------PLDKLRMVVLPNGALEIDEVGP 211
            |...|.:|...     ..:|.|::   |.:.|           |..|::.....|..|.|:.:..
Mosquito    74 AILNCRVGMLK-----DKTVMWIRRTTDKVSLLTVGNNTYSGDPRIKVKFQYPNNWRLHINPIKS 133

  Fly   212 SDRGSYQCNVTSGSSSRLSSKTNLNIKKPS-----DPGAENS---------------VAPSFL-- 254
            .|.|.|.|.|::......:  |||.:.:|:     :.|.|.|               |:.|:|  
Mosquito   134 DDAGLYMCQVSTHPPRVFA--TNLTVLEPAVRIVDEMGYEFSDRYYKLGSTIEISCQVSTSYLAT 196

  Fly   255 VGPSPK----------------------TVREGDTVTLD--CVANGVPKPQIKWLRNGMDLDFND 295
            :.||||                      |.:.|...|.|  .:::...:..|.|.::|.:|   .
Mosquito   197 LPPSPKSAGQQQRSKTSPVGASANALDETAKTGSKATKDDNKLSDSTERGLISWTKDGAEL---P 258

  Fly   296 LDSRFSIVGT-----GSLQISSAEDIDSGNYQCRASNTVDSLDAQATVQVQEPPKFIKAPKDTTA 355
            .|.:.|..||     ..:.|..|..:.:|.|.|    ||....:|| .|||              
Mosquito   259 KDVKMSFSGTKQWLISRISILQANRVHNGVYNC----TVAGKQSQA-AQVQ-------------- 304

  Fly   356 HEKDEPELKCDIWGKPKPVIRWLKNGDLITPNDYMQLVDGHNLKILGLLNSDAGM---FQCVGTN 417
                                  :.||:  || ..:|...||:::..||:    |:   |.|....
Mosquito   305 ----------------------VLNGE--TP-AAVQHNFGHHIEATGLV----GLHCPFWCGTLY 340

  Fly   418 AAGSVHAAARL 428
            :.|||.....|
Mosquito   341 SFGSVRVGLEL 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fraNP_523716.2 Ig 36..140 CDD:299845
Ig <180..222 CDD:299845 13/55 (24%)
IG_like 257..340 CDD:214653 25/111 (23%)
IGc2 264..327 CDD:197706 16/69 (23%)
I-set 344..430 CDD:254352 16/88 (18%)
Ig 363..428 CDD:299845 15/67 (22%)
FN3 611..703 CDD:238020
FN3 711..799 CDD:238020
FN3 806..897 CDD:238020
FN3 908..989 CDD:238020
FN3 1011..1097 CDD:238020
FN3 1109..1205 CDD:238020
Neogenin_C 1273..1521 CDD:284094
AgaP_AGAP002708XP_312220.4 IG_like 74..157 CDD:214653 20/89 (22%)
Ig <90..158 CDD:299845 16/69 (23%)
I-set <248..305 CDD:254352 20/100 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.