Sequence 1: | NP_610795.1 | Gene: | CG8569 / 36376 | FlyBaseID: | FBgn0033752 | Length: | 608 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_006537918.1 | Gene: | E130308A19Rik / 230259 | MGIID: | 2442164 | Length: | 755 | Species: | Mus musculus |
Alignment Length: | 244 | Identity: | 59/244 - (24%) |
---|---|---|---|
Similarity: | 80/244 - (32%) | Gaps: | 73/244 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 372 LQRHELVFAKQVGSPPWPAKVMSVSKRQPIKYDVRFFG--GTHSRALISERDIT---PIESDIQS 431
Fly 432 HIKPRNSRALSAAIKELQCHMMLSHYSASLFGFHADPTVAENLIKVALSHCTESTETSASGKRGR 496
Fly 497 PPTPATPGAAKNRRLNNTTSNTSSPVPI-------RGI-----PDSVAYDSLTAEILQAH----- 544
Fly 545 -----------------NDLLN--CRRELSATQRKLAEVKRKQWCYHCL 574 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG8569 | NP_610795.1 | PHD_SF | 85..120 | CDD:304600 | |
Bromo_ZMYND11 | 243..350 | CDD:99924 | |||
BS69_related | 366..451 | CDD:99902 | 24/83 (29%) | ||
zf-MYND | 570..604 | CDD:280009 | 2/5 (40%) | ||
E130308A19Rik | XP_006537918.1 | DUF5585 | <226..>386 | CDD:375359 | 39/151 (26%) |
DUF3504 | 577..725 | CDD:371846 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3612 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |