DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8569 and E130308A19Rik

DIOPT Version :9

Sequence 1:NP_610795.1 Gene:CG8569 / 36376 FlyBaseID:FBgn0033752 Length:608 Species:Drosophila melanogaster
Sequence 2:XP_006537918.1 Gene:E130308A19Rik / 230259 MGIID:2442164 Length:755 Species:Mus musculus


Alignment Length:244 Identity:59/244 - (24%)
Similarity:80/244 - (32%) Gaps:73/244 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   372 LQRHELVFAKQVGSPPWPAKVMSVSKRQPIKYDVRFFG--GTHSRALISERDIT---PIESDIQS 431
            |..|.|..:..|.|.|...|...||...|.:      |  |.|..|    ..:|   |:.:   |
Mouse   264 LDPHILSASPSVISRPIIPKTARVSLASPNR------GPPGAHGTA----HQVTMQMPVST---S 315

  Fly   432 HIKPRNSRALSAAIKELQCHMMLSHYSASLFGFHADPTVAENLIKVALSHCTESTETSASGKRGR 496
            |...:.|..|||    ||........::..|..|....|:.  .:||||. :.:||...|..:.:
Mouse   316 HPNKQISIPLSA----LQLPGQDEQVASEEFLPHLPSQVSS--CEVALSP-SVNTEPEVSSSQQQ 373

  Fly   497 PPTPATPGAAKNRRLNNTTSNTSSPVPI-------RGI-----PDSVAYDSLTAEILQAH----- 544
            ||...|          .||..|:..:|:       |||     |.:|...|.  ..||.:     
Mouse   374 PPAAPT----------ITTEATAQCIPVNIFTAPPRGIRTLPEPGNVLCSSW--RYLQGYYCMAI 426

  Fly   545 -----------------NDLLN--CRRELSATQRKLAEVKRKQWCYHCL 574
                             ||.||  |...:|....|........|.|.|:
Mouse   427 GLLSYSTKLNKFPVFNINDDLNGLCTSAVSPNTTKATRYALNVWRYWCM 475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8569NP_610795.1 PHD_SF 85..120 CDD:304600
Bromo_ZMYND11 243..350 CDD:99924
BS69_related 366..451 CDD:99902 24/83 (29%)
zf-MYND 570..604 CDD:280009 2/5 (40%)
E130308A19RikXP_006537918.1 DUF5585 <226..>386 CDD:375359 39/151 (26%)
DUF3504 577..725 CDD:371846
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3612
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.