DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8569 and bra-1

DIOPT Version :9

Sequence 1:NP_610795.1 Gene:CG8569 / 36376 FlyBaseID:FBgn0033752 Length:608 Species:Drosophila melanogaster
Sequence 2:NP_510277.1 Gene:bra-1 / 181481 WormBaseID:WBGene00000262 Length:183 Species:Caenorhabditis elegans


Alignment Length:79 Identity:28/79 - (35%)
Similarity:46/79 - (58%) Gaps:6/79 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   531 VAYDSLTAEILQAHNDLLNCRRELSAT----QRKLAEVKRKQWCYHCLDEAVFNCCFTASYCSVE 591
            :..|....|:.:.|.:  |.:.|:...    ||:||..|:||||:.|..||:::||:..:|||||
 Worm    84 IELDQTKEELEKKHAE--NLKEEIEKLSEKHQRELAVAKKKQWCWQCNSEAIYHCCWNTAYCSVE 146

  Fly   592 CQRRDKRRHQASCK 605
            ||:...:.|:..|:
 Worm   147 CQQGHWQIHRKFCR 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8569NP_610795.1 PHD_SF 85..120 CDD:304600
Bromo_ZMYND11 243..350 CDD:99924
BS69_related 366..451 CDD:99902
zf-MYND 570..604 CDD:280009 14/33 (42%)
bra-1NP_510277.1 PRK12704 39..>116 CDD:237177 7/33 (21%)
zf-MYND 125..159 CDD:366792 14/33 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3612
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D183667at33208
OrthoFinder 1 1.000 - - FOG0006060
OrthoInspector 1 1.000 - - mtm4784
orthoMCL 1 0.900 - - OOG6_107217
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3824
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.750

Return to query results.
Submit another query.