DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment achi and TGIF2LY

DIOPT Version :9

Sequence 1:NP_001286352.1 Gene:achi / 36373 FlyBaseID:FBgn0033749 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_631960.1 Gene:TGIF2LY / 90655 HGNCID:18569 Length:185 Species:Homo sapiens


Alignment Length:181 Identity:62/181 - (34%)
Similarity:93/181 - (51%) Gaps:33/181 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 LENEGRGRFHSDSSLDQDSLHADVIVEEDQSTEHGANQVQNYHDMMVDSEHHIDINGSL------ 93
            :|....|...:.|.:::||         ...|:..|      .|..:.|.::.|....|      
Human     1 MEAAADGPAETQSPVEKDS---------PAKTQSPA------QDTSIMSRNNADTGRVLALPEHK 50

  Fly    94 RKRRGNLPKTSVKILKRWLYEHRYNAYPSDAEKFTLSQEANLTVLQVCNWFINARRRILPEMIRR 158
            :||:||||..|||||:.|:|:||:.||||:.||..||::.||::|::.||||||||||||:|:::
Human    51 KKRKGNLPAESVKILRDWMYKHRFKAYPSEEEKQMLSEKTNLSLLRISNWFINARRRILPDMLQQ 115

  Fly   159 EGNDPL--HFTISRRGKKVSPNCSRSSALGANLTGPNPAHGSPASEVVVGA 207
            ..|||:  |.|    ||.......:|:....      ||...|..:.:..|
Human   116 RRNDPIIGHKT----GKDAHATHLQSTEASV------PAKSGPVVQTMYKA 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
achiNP_001286352.1 Homeobox_KN 111..150 CDD:283551 22/38 (58%)
TGIF2LYNP_631960.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..58 15/71 (21%)
Homeobox_KN 68..107 CDD:310480 22/38 (58%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 166..185
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152667
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D627308at33208
OrthoFinder 1 1.000 - - FOG0002434
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.