DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment achi and TOS8

DIOPT Version :10

Sequence 1:NP_725183.1 Gene:achi / 36373 FlyBaseID:FBgn0033749 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_011419.1 Gene:TOS8 / 852783 SGDID:S000003064 Length:276 Species:Saccharomyces cerevisiae


Alignment Length:86 Identity:39/86 - (45%)
Similarity:49/86 - (56%) Gaps:7/86 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 RRGNLPKTSVKILKRWLYEHRYNAYPSDAEKFTLSQEANLTVLQVCNWFINARRRILPEMIRREG 160
            :|.||||.:|.||.:||:||..|.||:..||..|..:..||.||:.|||||||||    .|....
Yeast   197 KRSNLPKATVSILNKWLHEHVNNPYPTVQEKRELLAKTGLTKLQISNWFINARRR----KIFSGQ 257

  Fly   161 NDPLHFTISRRGKKVSPNCSR 181
            ||..:|   ||....|.|.::
Yeast   258 NDANNF---RRKFSSSTNLAK 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
achiNP_725183.1 Homeobox_KN 112..150 CDD:428673 20/37 (54%)
TOS8NP_011419.1 Homeobox_KN 213..251 CDD:428673 20/37 (54%)

Return to query results.
Submit another query.