DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment achi and HMLALPHA2

DIOPT Version :9

Sequence 1:NP_001286352.1 Gene:achi / 36373 FlyBaseID:FBgn0033749 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_009866.1 Gene:HMLALPHA2 / 850292 SGDID:S000000572 Length:210 Species:Saccharomyces cerevisiae


Alignment Length:122 Identity:35/122 - (28%)
Similarity:56/122 - (45%) Gaps:18/122 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 VIVEEDQSTEHGANQVQNYH--------DMMVDSEHHID-INGSLRKRRGN-LPKTSVKILKRWL 112
            |:::|.:|.|   |...||.        |.:|.:....| ||.|.:..||: ..|.:|:||:.|.
Yeast    87 VLLKEMRSIE---NDRSNYQLTQKNKSADGLVFNVVTQDMINKSTKPYRGHRFTKENVRILESWF 148

  Fly   113 YEHRYNAYPSDAEKFTLSQEANLTVLQVCNWFINARRR-----ILPEMIRREGNDPL 164
            .::..|.|........|.:..:|:.:|:.||..|.||:     |.||:......:||
Yeast   149 AKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEKTITIAPELADLLSGEPL 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
achiNP_001286352.1 Homeobox_KN 111..150 CDD:283551 10/38 (26%)
HMLALPHA2NP_009866.1 HOX 135..188 CDD:197696 15/52 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0773
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.