DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment achi and KNAT2

DIOPT Version :10

Sequence 1:NP_725183.1 Gene:achi / 36373 FlyBaseID:FBgn0033749 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_001320784.1 Gene:KNAT2 / 843388 AraportID:AT1G70510 Length:314 Species:Arabidopsis thaliana


Alignment Length:126 Identity:36/126 - (28%)
Similarity:60/126 - (47%) Gaps:19/126 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 ASLLENEGRGRFHSDSSLDQDSLHADVIVEEDQSTEHGANQVQNYHD----MMVDSEHHID---I 89
            |:.|.::  |...||..|.:|.   |:..::.|       |..|..|    ::.....||.   :
plant   178 ATALSDD--GAVSSDEELREDD---DIAADDSQ-------QRSNDRDLKDQLLRKFGSHISSLKL 230

  Fly    90 NGSLRKRRGNLPKTSVKILKRWLYEHRYNAYPSDAEKFTLSQEANLTVLQVCNWFINARRR 150
            ..|.:|::|.||:.:.:.|..|...|....||::.:|.:|::|..|...|:.|||||.|:|
plant   231 EFSKKKKKGKLPREARQALLDWWNVHNKWPYPTEGDKISLAEETGLDQKQINNWFINQRKR 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
achiNP_725183.1 Homeobox_KN 112..150 CDD:428673 14/37 (38%)
KNAT2NP_001320784.1 KNOX1 68..107 CDD:461051
KNOX2 121..172 CDD:427506
ELK 212..233 CDD:427504 3/20 (15%)
Homeobox_KN 253..291 CDD:428673 14/37 (38%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.