DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment achi and KNAT7

DIOPT Version :9

Sequence 1:NP_001286352.1 Gene:achi / 36373 FlyBaseID:FBgn0033749 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_564805.1 Gene:KNAT7 / 842602 AraportID:AT1G62990 Length:291 Species:Arabidopsis thaliana


Alignment Length:178 Identity:48/178 - (26%)
Similarity:73/178 - (41%) Gaps:52/178 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LDRHVR----------QNIQDMMHEAHVQASLLENEGRGRFHSDSSLDQDSLHADVIVEEDQSTE 67
            |.:|||          :.|::.:|.. ..|:|  .||.|...|:   |:|.|..|.      |::
plant   108 LQQHVRVHAVEAVMACREIENNLHSL-TGATL--GEGSGATMSE---DEDDLPMDF------SSD 160

  Fly    68 HGANQVQNYHDMM-------VDSEHHI---------------------DINGS-LRKRR-GNLPK 102
            :........|||.       .:||..:                     |:... :|||| |.||.
plant   161 NSGVDFSGGHDMTGFGPLLPTESERSLMERVRQELKLELKQGFKSRIEDVREEIMRKRRAGKLPG 225

  Fly   103 TSVKILKRWLYEHRYNAYPSDAEKFTLSQEANLTVLQVCNWFINARRR 150
            .:..:||.|..:|....||::.:|..|.:|..|.:.|:.|||||.|:|
plant   226 DTTTVLKNWWQQHCKWPYPTEDDKAKLVEETGLQLKQINNWFINQRKR 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
achiNP_001286352.1 Homeobox_KN 111..150 CDD:283551 15/38 (39%)
KNAT7NP_564805.1 KNOX1 29..67 CDD:281744
KNOX2 84..134 CDD:281745 6/26 (23%)
Homeobox_KN 234..273 CDD:283551 15/38 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0773
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.