DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment achi and STM

DIOPT Version :9

Sequence 1:NP_001286352.1 Gene:achi / 36373 FlyBaseID:FBgn0033749 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_176426.1 Gene:STM / 842534 AraportID:AT1G62360 Length:382 Species:Arabidopsis thaliana


Alignment Length:170 Identity:37/170 - (21%)
Similarity:60/170 - (35%) Gaps:60/170 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 GRFHSDSSLDQ-DSLHADVIVEEDQSTE----------------------HGANQVQNYHDMMVD 82
            |....|..||| ...:.:::|:.:|...                      ...:....|.:..:|
plant   172 GCLGEDPGLDQFMEAYCEMLVKYEQELSKPFKEAMVFLQRVECQFKSLSLSSPSSFSGYGETAID 236

  Fly    83 ------SEHHIDIN-------------------------GSL------RKRRGNLPKTSVKILKR 110
                  ||..:|:|                         |||      ::::|.|||.:.:.|..
plant   237 RNNNGSSEEEVDMNNEFVDPQAEDRELKGQLLRKYSGYLGSLKQEFMKKRKKGKLPKEARQQLLD 301

  Fly   111 WLYEHRYNAYPSDAEKFTLSQEANLTVLQVCNWFINARRR 150
            |...|....|||:.:|..|::...|...|:.|||||.|:|
plant   302 WWSRHYKWPYPSEQQKLALAESTGLDQKQINNWFINQRKR 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
achiNP_001286352.1 Homeobox_KN 111..150 CDD:283551 15/38 (39%)
STMNP_176426.1 KNOX1 121..156 CDD:397730
KNOX2 173..216 CDD:397731 6/42 (14%)
ELK 262..283 CDD:397729 3/20 (15%)
Homeobox_KN 302..341 CDD:399131 15/38 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0773
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.