DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment achi and KNAT6

DIOPT Version :10

Sequence 1:NP_725183.1 Gene:achi / 36373 FlyBaseID:FBgn0033749 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_173752.3 Gene:KNAT6 / 838946 AraportID:AT1G23380 Length:329 Species:Arabidopsis thaliana


Alignment Length:108 Identity:27/108 - (25%)
Similarity:47/108 - (43%) Gaps:14/108 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 DVIVEEDQSTEHGANQV-----QNYHDMMVDSE---------HHIDINGSLRKRRGNLPKTSVKI 107
            |.::..|:....|.::|     |...|..:...         ..:.:..|.:|::|.||:.:.:.
plant   198 DGVISSDEELSGGDHEVAEDGRQRCEDRDLKDRLLRKFGSRISTLKLEFSKKKKKGKLPREARQA 262

  Fly   108 LKRWLYEHRYNAYPSDAEKFTLSQEANLTVLQVCNWFINARRR 150
            |..|...|....||::.:|..|:....|...|:.|||||.|:|
plant   263 LLDWWNLHYKWPYPTEGDKIALADATGLDQKQINNWFINQRKR 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
achiNP_725183.1 Homeobox_KN 112..150 CDD:428673 13/37 (35%)
KNAT6NP_173752.3 KNOX1 84..125 CDD:461051
KNOX2 139..186 CDD:427506
ELK 226..247 CDD:427504 0/20 (0%)
Homeobox_KN 267..305 CDD:428673 13/37 (35%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.