DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment achi and RPL

DIOPT Version :9

Sequence 1:NP_001286352.1 Gene:achi / 36373 FlyBaseID:FBgn0033749 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_195823.1 Gene:RPL / 831745 AraportID:AT5G02030 Length:575 Species:Arabidopsis thaliana


Alignment Length:280 Identity:65/280 - (23%)
Similarity:117/280 - (41%) Gaps:61/280 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 VEEDQSTEHGANQVQNYHDMM----VDS--------------EHHIDINGSLRKRRGNLPKTSVK 106
            :::.|...|..|. :|..|.:    .||              :||..:   .|..|| ||:.:|.
plant   302 IQQQQQCGHPMNS-ENKTDSLRFGGSDSSRGLCSAGQRHGFPDHHAPV---WRPHRG-LPERAVT 361

  Fly   107 ILKRWLYEHRYNAYPSDAEKFTLSQEANLTVLQVCNWFINARRRILPEMIRREGNDPLHFTISRR 171
            :|:.||::|..:.||:|.:|..|:::..|:..||.|||||||.|:...|:     :.:|...:|:
plant   362 VLRAWLFDHFLHPYPTDTDKLMLAKQTGLSRNQVSNWFINARVRVWKPMV-----EEIHMLETRQ 421

  Fly   172 GKKVSPNCSRSSALGANLTGPNPAHGSPASEVVVGATEEVDGAG--------EIHEGIANVLTNF 228
            .::.|.:..|.......:. |:.::.:|:|.   .|.:..:.:.        ::|.     ..|.
plant   422 SQRSSSSSWRDERTSTTVF-PDNSNNNPSSS---SAQQRPNNSSPPRRARNDDVHG-----TNNN 477

  Fly   229 EQYVQGPNGQMVKMEPEYEDSVIYSWQQAIANNPMGFQSLHSSLQATM-----IDKIKNYQMRKA 288
            ..||...:|.        ..:|.:|:....:|.|:...|.:..:..|:     |...:.:.|..|
plant   478 NSYVNSGSGG--------GSAVGFSYGIGSSNVPVMNSSTNGGVSLTLGLHHQIGLPEPFPMTTA 534

  Fly   289 AAI---GGSAVGSGGAGGSS 305
            ...   |||..|.||..|.:
plant   535 QRFGLDGGSGDGGGGYEGQN 554

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
achiNP_001286352.1 Homeobox_KN 111..150 CDD:283551 18/38 (47%)
RPLNP_195823.1 POX 165..292 CDD:214728
Homeobox_KN 366..405 CDD:283551 18/38 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0773
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
43.770

Return to query results.
Submit another query.