DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment achi and KNAT4

DIOPT Version :9

Sequence 1:NP_001286352.1 Gene:achi / 36373 FlyBaseID:FBgn0033749 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_196667.2 Gene:KNAT4 / 830973 AraportID:AT5G11060 Length:393 Species:Arabidopsis thaliana


Alignment Length:204 Identity:60/204 - (29%)
Similarity:84/204 - (41%) Gaps:48/204 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LDRHVRQN-IQDMMHEAHVQASLLE------NEGRGRFHS--------------DSSLDQDSLHA 56
            |.:|||.: ::.:|....::.||..      .||.|...|              |.|||......
plant   205 LQQHVRVHAMEAVMACWEIEQSLQSFTGVSPGEGTGATMSEDEDEQVESDAHLFDGSLDGLGFGP 269

  Fly    57 DVIVEEDQSTEHGANQ------VQNYHDMMVDSEHHIDINGSLRKRR-GNLPKTSVKILKRWLYE 114
            .|..|.::|......|      .|.|.:.:||....|     ||||| |.||..:..:||.|...
plant   270 LVPTESERSLMERVRQELKHELKQGYKEKIVDIREEI-----LRKRRAGKLPGDTTSVLKSWWQS 329

  Fly   115 HRYNAYPSDAEKFTLSQEANLTVLQVCNWFINARRRILPEMIRREGNDPLHFTISRRGKKVSPNC 179
            |....||::.:|..|.||..|.:.|:.|||||.|:       |...::|...|:|:       |.
plant   330 HSKWPYPTEEDKARLVQETGLQLKQINNWFINQRK-------RNWHSNPSSSTVSK-------NK 380

  Fly   180 SRSSALGAN 188
            .||:| |.|
plant   381 RRSNA-GEN 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
achiNP_001286352.1 Homeobox_KN 111..150 CDD:283551 16/38 (42%)
KNAT4NP_196667.2 KNOX1 124..161 CDD:281744
KNOX2 182..231 CDD:281745 7/25 (28%)
ELK 286..307 CDD:281743 5/25 (20%)
Homeobox_KN 326..365 CDD:283551 16/45 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0773
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.