DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment achi and BLH2

DIOPT Version :9

Sequence 1:NP_001286352.1 Gene:achi / 36373 FlyBaseID:FBgn0033749 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_001031797.4 Gene:BLH2 / 829840 AraportID:AT4G36870 Length:739 Species:Arabidopsis thaliana


Alignment Length:271 Identity:69/271 - (25%)
Similarity:104/271 - (38%) Gaps:55/271 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 EHGANQVQNYHDM-MVDSEHHIDINGSLRKRRGNLPKTSVKILKRWLYEHRYNAYPSDAEKFTLS 130
            |....|.:.:|.| |::.|       :.|.:|| ||:.||.||:.||:||..:.|||||:|..|:
plant   479 EQSLRQNRAFHQMGMMEQE-------AWRPQRG-LPERSVNILRAWLFEHFLHPYPSDADKHLLA 535

  Fly   131 QEANLTVLQVCNWFINARRRILPEMIR----------------REGNDPLHFTISRRGKKVSPNC 179
            ::..|:..||.|||||||.|:...|:.                .|..:......|...|....|.
plant   536 RQTGLSRNQVSNWFINARVRLWKPMVEEMYQQESKEREREEELEENEEDQETKNSNDDKSTKSNN 600

  Fly   180 SRSSALGANLTGPNPAHGSP---ASEVVVGATEEVDGAGEIHEGIANVLTNFEQY--VQGPNGQM 239
            :.|:......|...|...:|   .::..|.....:......:|..|:.|.....|  ...|....
plant   601 NESNFTAVRTTSQTPTTTAPDASDADAAVATGHRLRSNINAYENDASSLLLPSSYSNAAAPAAVS 665

  Fly   240 VKMEPEYEDSVIYS----WQQAI----------------ANNPMGFQSLHSSLQ--ATMIDKIKN 282
            ..:...|..|..:|    .||::                ..||.|..||...|:  ..|.||..:
plant   666 DDLNSRYGGSDAFSAVATCQQSVGGFDDADMDGVNVIRFGTNPTGDVSLTLGLRHAGNMPDKDAS 730

  Fly   283 YQMRKAAAIGG 293
            :.:|:   .||
plant   731 FCVRE---FGG 738

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
achiNP_001286352.1 Homeobox_KN 111..150 CDD:283551 21/38 (55%)
BLH2NP_001031797.4 POX 310..445 CDD:214728
Homeobox_KN 516..555 CDD:283551 21/38 (55%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0773
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
32.860

Return to query results.
Submit another query.