DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment achi and BLH6

DIOPT Version :10

Sequence 1:NP_725183.1 Gene:achi / 36373 FlyBaseID:FBgn0033749 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_195187.1 Gene:BLH6 / 829613 AraportID:AT4G34610 Length:532 Species:Arabidopsis thaliana


Alignment Length:183 Identity:49/183 - (26%)
Similarity:77/183 - (42%) Gaps:51/183 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 INGSLRKRRG-----------NLPKTSVKILKRWLYEHRYNAYPSDAEKFTLSQEANLTVLQVCN 142
            ::..||::||           .||:.||.||:.||:||..:.||.|::|..|:::..|:..||.|
plant   299 VDQHLRQQRGFMQPQAWRPQRGLPENSVLILRAWLFEHFLHPYPKDSDKIMLARQTGLSRGQVSN 363

  Fly   143 WFINARRRILPEMI---------RREGNDPLHFT--ISRRGKKVSPNCSRSSALGANLTGPNPAH 196
            ||||||.|:...|:         ..:.|.....|  :|..|...:.:..|:.....:.|.|:..|
plant   364 WFINARVRLWKPMVEEIYKEEFTENDSNSSSENTPKMSEIGPVAADDEDRAREFSQDQTKPDHGH 428

  Fly   197 GSPASEVVVGATEEVDGAGEIHEGIANVLTNFEQYVQGPN---GQMVKMEPEY 246
                            |.||...|:          |||.:   .:.:.:||.|
plant   429 ----------------GYGEETRGM----------VQGSHMDGRRFMAVEPTY 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
achiNP_725183.1 Homeobox_KN 112..150 CDD:428673 18/37 (49%)
BLH6NP_195187.1 POX 135..269 CDD:214728
Homeobox_KN 333..371 CDD:428673 18/37 (49%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.