DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment achi and KNAT5

DIOPT Version :10

Sequence 1:NP_725183.1 Gene:achi / 36373 FlyBaseID:FBgn0033749 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_194932.1 Gene:KNAT5 / 829335 AraportID:AT4G32040 Length:383 Species:Arabidopsis thaliana


Alignment Length:102 Identity:33/102 - (32%)
Similarity:49/102 - (48%) Gaps:12/102 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 QNYHDMMVDSEHHIDINGSLRKRR-GNLPKTSVKILKRWLYEHRYNAYPSDAEKFTLSQEANLTV 137
            |.:.:.:||....|     :|||| |.||..:..:||.|...|....||::.:|..|.||..|.:
plant   288 QGFKEKIVDIREEI-----MRKRRAGKLPGDTTSVLKEWWRTHSKWPYPTEEDKAKLVQETGLQL 347

  Fly   138 LQVCNWFINARRRILPEMIRREGNDPLHFTISRRGKK 174
            .|:.|||||.|:|      ....|.....|:::..:|
plant   348 KQINNWFINQRKR------NWNSNSSTSSTLTKNKRK 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
achiNP_725183.1 Homeobox_KN 112..150 CDD:428673 15/37 (41%)
KNAT5NP_194932.1 KNOX1 117..156 CDD:461051
KNOX2 170..221 CDD:427506
ELK 281..302 CDD:427504 4/18 (22%)
Homeobox_KN 322..360 CDD:428673 15/37 (41%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.