DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment achi and KNAT1

DIOPT Version :9

Sequence 1:NP_001286352.1 Gene:achi / 36373 FlyBaseID:FBgn0033749 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_192555.1 Gene:KNAT1 / 826364 AraportID:AT4G08150 Length:398 Species:Arabidopsis thaliana


Alignment Length:163 Identity:42/163 - (25%)
Similarity:70/163 - (42%) Gaps:35/163 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PEQEEVNMV--LDRHVRQNIQDMMHEAHVQASLLEN-EGRGRFHSDSSLDQDSLHADVIVEEDQS 65
            |.||.:..:  ::..:....|..:|       :|.| :|:    ||:....|        ||.::
plant   215 PIQEAMEFIRRIESQLSMLCQSPIH-------ILNNPDGK----SDNMGSSD--------EEQEN 260

  Fly    66 TEHGANQVQNYHDMMVDSE--HHI--DING---------SLRKRRGNLPKTSVKILKRWLYEHRY 117
            ...|..::........|.|  :|:  ..:|         |.:|::|.|||.:.:.|..|...|..
plant   261 NSGGETELPEIDPRAEDRELKNHLLKKYSGYLSSLKQELSKKKKKGKLPKEARQKLLTWWELHYK 325

  Fly   118 NAYPSDAEKFTLSQEANLTVLQVCNWFINARRR 150
            ..|||::||..|::...|...|:.|||||.|:|
plant   326 WPYPSESEKVALAESTGLDQKQINNWFINQRKR 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
achiNP_001286352.1 Homeobox_KN 111..150 CDD:283551 16/38 (42%)
KNAT1NP_192555.1 KNOX1 133..172 CDD:281744
KNOX2 189..234 CDD:281745 3/18 (17%)
ELK 279..300 CDD:281743 3/20 (15%)
Homeobox_KN 319..358 CDD:283551 16/38 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0773
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.